Dbfetch

ID   AY255577; SV 1; linear; mRNA; STD; MUS; 381 BP.
XX
AC   AY255577;
XX
DT   09-APR-2003 (Rel. 75, Created)
DT   09-APR-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Mus musculus brain-specific angiogenesis inhibitor 2 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-381
RX   DOI; 10.1073/pnas.0230374100.
RX   PUBMED; 12679517.
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   "The G protein-coupled receptor repertoires of human and mouse";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(8):4903-4908(2003).
XX
RN   [2]
RP   1-381
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   Primal, Inc., 1124 Columbia Street, Seattle, WA 98104, USA
XX
DR   MD5; 48671e914c594598d41698e547831685.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..381
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>381
FT                   /codon_start=1
FT                   /product="brain-specific angiogenesis inhibitor 2"
FT                   /note="G protein-coupled receptor"
FT                   /db_xref="GOA:Q80T61"
FT                   /db_xref="InterPro:IPR008077"
FT                   /db_xref="MGI:MGI:2451244"
FT                   /db_xref="UniProtKB/TrEMBL:Q80T61"
FT                   /protein_id="AAO85089.1"
FT                   /translation="LPRRTLSLQPGGGGTAGEEAPRARPEGTPRRAAKTVAHTEGYPSF
FT                   LSVEHSGLGLGPAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLG
FT                   SLERKKLRYSDLDFEKVMHTRKR"
XX
SQ   Sequence 381 BP; 78 A; 123 C; 118 G; 62 T; 0 other;
     ctgccccggc ggactttgag cctgcagcct ggtggtgggg gtacagcggg tgaggaggcc        60
     ccaagggccc ggcctgaggg gaccccccgg cgggctgcca aaacggtagc ccacactgaa       120
     ggctacccca gcttcctgtc tgtggagcac tcgggtctag ggctgggccc tgcctatggg       180
     tctctccaga acccgtatgg aatgaccttc caaccaccac caccaacacc cagcgcccgc       240
     caagtaccag agccaggaga acgtagccgg accatgcccc gtacagtgcc tggttccacc       300
     atgaagctgg gctcccttga gcgaaagaag cttcggtatt cggacttgga ctttgagaag       360
     gtgatgcaca ctcggaaacg g                                                 381
//