Dbfetch

ID   AY255571; SV 1; linear; mRNA; STD; MUS; 312 BP.
XX
AC   AY255571;
XX
DT   08-APR-2003 (Rel. 75, Created)
DT   08-APR-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Mus musculus G protein-coupled receptor GPR82 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-312
RX   DOI; 10.1073/pnas.0230374100.
RX   PUBMED; 12679517.
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   "The G protein-coupled receptor repertoires of human and mouse";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(8):4903-4908(2003).
XX
RN   [2]
RP   1-312
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   Primal, Inc., 1124 Columbia Street, Seattle, WA 98104, USA
XX
DR   MD5; c3922ebdcb1543ff54abc6dd4871dd20.
DR   Ensembl-Gn; ENSMUSG00000047678; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035575; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0035553; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0035485; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035546; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035262; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036075; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034554; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0035231; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0035384; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0035331; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0035466; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035374; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036087; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034255; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034690; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000053659; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095708; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0095795; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0095748; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095712; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095285; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096233; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0095889; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0095203; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0095406; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0095252; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0095427; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095231; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095303; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094271; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..312
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>312
FT                   /codon_start=1
FT                   /product="G protein-coupled receptor GPR82"
FT                   /db_xref="GOA:Q8BZR0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441734"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BZR0"
FT                   /protein_id="AAO85083.1"
FT                   /translation="ATSCYERMFYGHVLKRFRQPNFARTMCIYIWGVVLVIIIPVTLYY
FT                   SVVEATEEGQSQCYNRQMELGARPSQIAGLIGTTFIGFSFLVVVTSYYSLVSHLRRVRT
FT                   "
XX
SQ   Sequence 312 BP; 85 A; 69 C; 70 G; 88 T; 0 other;
     gccacctcat gctacgagag aatgttttat ggtcacgtac tgaaaagatt tcgccagccc        60
     aactttgcca gaacaatgtg tatttacata tggggagttg tgcttgtcat aattattcca       120
     gttaccctat actactcagt agtcgaggct acagaagaag gacagagcca gtgctacaat       180
     cggcagatgg aactgggagc cagaccttct cagattgcgg gtctcattgg aaccacattt       240
     attggattct cctttttagt agtagtgaca tcatactatt ctcttgtcag ccatctgcga       300
     agagtaagga cc                                                           312
//