Dbfetch

ID   AY255563; SV 1; linear; mRNA; STD; MUS; 423 BP.
XX
AC   AY255563;
XX
DT   08-APR-2003 (Rel. 75, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus D5 dopamine receptor mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-423
RX   DOI; 10.1073/pnas.0230374100.
RX   PUBMED; 12679517.
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   "The G protein-coupled receptor repertoires of human and mouse";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(8):4903-4908(2003).
XX
RN   [2]
RP   1-423
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   Primal, Inc., 1124 Columbia Street, Seattle, WA 98104, USA
XX
DR   MD5; fbac7e2d8571364a5add79a74480cb10.
DR   Ensembl-Gn; ENSMUSG00000039358; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0029511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0029477; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0029427; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0029488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0029211; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0029942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0028619; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0029178; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0029325; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0029284; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0029411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0029314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0029975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0028343; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0028700; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000041646; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0071448; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0071525; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0071441; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0071462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0071107; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0071940; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0071643; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0071046; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0071184; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0071091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0071249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0071125; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0072138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0071113; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0070260; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..423
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>423
FT                   /codon_start=1
FT                   /product="D5 dopamine receptor"
FT                   /note="G protein-coupled receptor DRD5"
FT                   /db_xref="GOA:Q8BLD9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000497"
FT                   /db_xref="InterPro:IPR000929"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:94927"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BLD9"
FT                   /protein_id="AAO85075.1"
FT                   /translation="DIWVAFDIMCSTASILNLCIISVDRYWAISRPFRYERKMTQRVAL
FT                   VMVALAWTLSILISFIPVQLNWHRDKAGSQGREGLLSNETPWEEGWELDGRTENCDSSL
FT                   NRTYAISSSLISFYIPVAIMIVTYTRIYRIAQVQIRR"
XX
SQ   Sequence 423 BP; 89 A; 132 C; 108 G; 94 T; 0 other;
     gacatctggg tggcctttga catcatgtgc tccactgctt ccatcctgaa tctgtgtatc        60
     atcagcgtgg accggtactg ggctatttcc agacccttcc gctacgagcg caagatgacc       120
     cagcgtgtag ccctggtcat ggtggccctg gcctggacct tgtccatcct catctccttt       180
     atcccggtcc aactcaattg gcacagagac aaggcaggct cccagggccg agagggcctg       240
     ctgtccaatg agacaccctg ggaggaaggt tgggagctag acgggagaac agagaactgt       300
     gactccagcc tgaaccgaac ctacgccatc tcctcgtcgc tcatcagctt ctatatcccg       360
     gtagccatca tgatagtgac ctacacgcgc atctaccgca ttgcacaggt tcagatccgc       420
     cgt                                                                     423
//