spacer

EBI Dbfetch

ID   AY255561; SV 1; linear; mRNA; STD; MUS; 597 BP.
XX
AC   AY255561;
XX
DT   08-APR-2003 (Rel. 75, Created)
DT   12-APR-2003 (Rel. 75, Last updated, Version 2)
XX
DE   Mus musculus endothelin B receptor-like protein-2 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-597
RX   DOI; 10.1073/pnas.0230374100.
RX   PUBMED; 12679517.
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   "The G protein-coupled receptor repertoires of human and mouse";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(8):4903-4908(2003).
XX
RN   [2]
RP   1-597
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   Primal, Inc., 1124 Columbia Street, Seattle, WA 98104, USA
XX
DR   MD5; 28617d2892c613c7526e8446165ef4ca.
DR   Ensembl-Gn; ENSMUSG00000026424; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027682; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..597
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>597
FT                   /codon_start=1
FT                   /product="endothelin B receptor-like protein-2"
FT                   /note="G protein-coupled receptor GPR37; ETBR-LP-2"
FT                   /db_xref="GOA:Q99JG2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR003909"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1928503"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99JG2"
FT                   /protein_id="AAO85073.1"
FT                   /translation="WVGSMMLAVPELLLWQLAQEPAPTAGTVDSCIMKPSADLPESVYS
FT                   LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKPECRAGRHEQCESQLNS
FT                   TVVGLTVVYAFCTLPENVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLC
FT                   ICRPLGQAFLDCCCCCCCEECGGASDSSATVSADSK"
XX
SQ   Sequence 597 BP; 99 A; 191 C; 174 G; 133 T; 0 other;
     tgggtgggct ccatgatgct ggccgtgccc gaactcctgc tatggcagct ggcccaggag        60
     ccggctccca ccgcaggaac tgtggactcg tgtatcatga aaccttcagc cgacctgccc       120
     gaatccgtct attcgctggt gatgacctac cagaatgccc gcatgtggtg gtattttggt       180
     tgctacttct gtctgcccat cctcttcacc gtcacctgtc agctggtgac gtggcgggtg       240
     cggggcccac caggcaggaa gcctgagtgt agagcgggca ggcatgagca gtgtgagagc       300
     cagctcaaca gcaccgtggt cggcctgact gtggtctatg ccttctgtac actccctgag       360
     aacgtctgca atatcgtggt ggcttacctc tctaccgagc tcacgcggca gaccctggac       420
     ctcctgggcc tcatcaacca gttctccacc ttctttaagg gcgccatcac ccctgtgctc       480
     ctcctgtgca tctgcaggcc actgggccag gcctttctgg attgctgctg ctgctgctgc       540
     tgcgaggagt gcggcggggc ctcagactcc tcagccacag tcagcgcgga cagcaag          597
//


spacer
spacer