Dbfetch

ID   AY255533; SV 1; linear; mRNA; STD; MUS; 342 BP.
XX
AC   AY255533;
XX
DT   08-APR-2003 (Rel. 75, Created)
DT   08-APR-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Mus musculus G protein-coupled receptor PGR7 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-342
RX   DOI; 10.1073/pnas.0230374100.
RX   PUBMED; 12679517.
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   "The G protein-coupled receptor repertoires of human and mouse";
RL   Proc. Natl. Acad. Sci. U.S.A. 100(8):4903-4908(2003).
XX
RN   [2]
RP   1-342
RA   Vassilatis D.K., Hohmann J.G., Zeng H., Li F., Ranchalis J.E.,
RA   Mortrud M.T., Brown A., Rodriguez S.S., Weller J.R., Wright A.C.,
RA   Bergmann J.E., Gaitanaris G.A.;
RT   ;
RL   Submitted (14-MAR-2003) to the INSDC.
RL   Primal, Inc., 1124 Columbia Street, Seattle, WA 98104, USA
XX
DR   MD5; ffdd5c798702ee208417b076e27e322a.
DR   Ensembl-Gn; ENSMUSG00000042816; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0024382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0024349; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0024318; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0024349; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0024115; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0024791; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0023590; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0024085; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0024215; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0024181; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0024299; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0024212; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0024840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0023334; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0023653; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000054738; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0049575; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0049557; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0049518; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0049518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0049251; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0050001; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0049355; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0049181; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0049278; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0049252; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0049402; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0049254; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0050116; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0048952; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0048544; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..342
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>342
FT                   /codon_start=1
FT                   /product="G protein-coupled receptor PGR7"
FT                   /db_xref="GOA:Q7TSN6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2441887"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7TSN6"
FT                   /protein_id="AAO85045.1"
FT                   /translation="SLLMAVCLVGLVGNLCVIGILLHGVWKRKPSTIHSLILNLSLADF
FT                   SLLLFSAPVRAAAYSKGVWDLGWFICKSSDWFTHVCMAAKSLTFVVVAKACFAYASDPA
FT                   KQESIHSRTI"
XX
SQ   Sequence 342 BP; 66 A; 98 C; 87 G; 91 T; 0 other;
     tctctcttga tggccgtgtg cctggtgggt ctcgtgggaa acctgtgtgt gattggcatt        60
     ctccttcatg gcgtttggaa aagaaagcca tccacgatcc actccctgat tctgaatcta       120
     agcctggctg acttctctct cctgctcttc tctgcacctg tccgagcggc agcatactcc       180
     aagggcgttt gggatctcgg ctggttcatc tgcaagtcct ctgactggtt cacccacgtg       240
     tgcatggcag ccaagagctt gacatttgtt gtggtagcca aagcatgctt cgcgtatgca       300
     agtgacccag ccaagcaaga gagtatccac agccgcacca tc                          342
//