Dbfetch

ID   AY251056; SV 1; linear; mRNA; STD; MUS; 2051 BP.
XX
AC   AY251056;
XX
DT   18-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus EFEMP1 (Efemp1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2051
RX   DOI; 10.1016/S1567-133X(03)00084-X.
RX   PUBMED; 12915309.
RA   Ehlermann J., Weber S., Pfisterer P., Schorle H.;
RT   "Cloning, expression and characterization of the murine Efemp1, a gene
RT   mutated in Doyne-Honeycomb retinal dystrophy";
RL   Brain Res. Gene Expr. Patterns 3(4):441-447(2003).
XX
RN   [2]
RP   1-2051
RA   Weber S.N., Schorle H.;
RT   ;
RL   Submitted (07-MAR-2003) to the INSDC.
RL   Developmental Pathology, Pathology, Sigmund Freud Strasse 25, Bonn, NRW
RL   53127, Germany
XX
DR   MD5; 41c3b878f548400eb56ae22e5f94d0d2.
DR   Ensembl-Gn; ENSMUSG00000020467; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018102; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018074; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018039; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018042; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017856; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018495; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017418; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017830; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017940; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017932; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018012; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017958; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018535; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017200; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017471; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000020759; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028333; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028298; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028261; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028276; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0028079; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028776; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027713; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0028001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028132; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028118; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0028247; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0028104; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028810; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027421; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027587; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2051
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11A4"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2051
FT                   /gene="Efemp1"
FT   CDS             125..1606
FT                   /codon_start=1
FT                   /gene="Efemp1"
FT                   /product="EFEMP1"
FT                   /db_xref="GOA:Q8BPB5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="InterPro:IPR032973"
FT                   /db_xref="InterPro:IPR037287"
FT                   /db_xref="MGI:MGI:1339998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BPB5"
FT                   /protein_id="AAP79577.1"
FT                   /translation="MLQTLFLTMLTLALVKSQYTEETITYTQCTDGYEWDPIRQQCKDI
FT                   DECDIVPDACKGGMKCVNHYGGYLCLPKTAQIIVNNEHPQQETPAAEASSGATTGTVAA
FT                   RSMATSGVVPGGGFMASATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGY
FT                   EQSEHNVCQDIDECTSGTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPP
FT                   YCHQRCVNTPGSFYCQCSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQ
FT                   GYELSSDRLNCEDIDECRTSSYLCQYQCVNEPGKFSCMCPQGYEVVRSRTCQDINECET
FT                   TNECREDEMCWNYHGGFRCYPRNPCQDHYVLTSENRCVCPVSNTMCRELPQSIVYKYMS
FT                   IRSDRSVPSDIFQIQATMIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGP
FT                   REYIVDLEMLTVSSIGTFRTSSVLRLTIIVGPFSF"
XX
SQ   Sequence 2051 BP; 625 A; 470 C; 443 G; 513 T; 0 other;
     cctcctcctg tggctgctgc tgcagccaga cctcgccagt tcagacctac caggctgccc        60
     tcccctacgc actccttcgc tgcccgggca ggaaagttgc gcggcccccc cgcagagaat       120
     cacgatgttg caaacacttt tcctaactat gctgactctg gcgctggtca agtcacagta       180
     caccgaggaa accatcacat acacgcaatg caccgatgga tatgaatggg accccataag       240
     acagcagtgt aaagatattg atgaatgtga cattgtccca gatgcttgca aaggtggaat       300
     gaaatgtgtc aaccactatg gaggatatct ctgccttcct aaaacagccc aaattattgt       360
     caataatgag catcctcagc aagaaacacc agctgcagaa gcttcgtcag gtgccaccac       420
     tgggactgta gctgccagga gcatggcaac cagtggtgtg gtgcctgggg gtggcttcat       480
     ggccagtgct actgcagttg ctggccctga agttcaaact ggccgaaata actttgtcat       540
     ccgaagaaac ccagctgacc ctcagcgcat cccttccaac ccttcccacc ggatccagtg       600
     tgcagcaggc tatgaacaga gtgagcataa tgtgtgccaa gatattgatg agtgcacctc       660
     agggactcac aattgtagaa cggaccaagt atgcatcaat ttacgaggtt ccttcacatg       720
     tcagtgtctt cctgggtatc agaagcgagg tgaacagtgt gtggatatag atgaatgcac       780
     agtgcctcca tattgccacc aaagatgtgt taacacacct ggttccttct actgccagtg       840
     cagtccaggg tttcagctgg cagcaaacaa ctacacttgt gtggatataa atgaatgtga       900
     tgccagcaac cagtgtgctc aacaatgcta caacattctt ggctcattca tctgtcagtg       960
     taatcaagga tatgaactaa gcagtgacag actcaactgt gaagacatcg acgaatgcag      1020
     aacctcaagc tacctatgcc aatatcaatg tgtcaatgaa cctgggaagt tctcatgtat      1080
     gtgcccacag ggttacgaag tggtgcgcag cagaacctgt caggatataa atgaatgtga      1140
     gaccaccaat gaatgccgag aagatgagat gtgctggaat taccatgggg gcttccgctg      1200
     ttacccacga aacccatgtc aagatcacta tgttctaaca tcagaaaacc gatgtgtttg      1260
     cccagtctca aacactatgt gccgggagct gccccagtcc attgtctaca aatacatgag      1320
     catccgatct gacaggtccg tgccttcaga catcttccag atacaggcaa caatgattta      1380
     tgcaaacacc attaatactt ttcggattaa atctggaaat gaaaatggag agttctacct      1440
     acgacaaaca agccctgtga gtgcaatgct ggtgcttgtg aagtctctat caggaccaag      1500
     agaatacatc gtggacctgg agatgctgac agtcagtagt ataggaacct tccgcacaag      1560
     ctctgtgtta agattgacaa taatagtggg gccattttca ttttagcctt ttactcatat      1620
     aaagcctact acaagcattt aaatcagcca aacaatatca ttaccttaaa actctatttt      1680
     atttatagct atatctagta catgtatatt caaatagcta gactatggta agaagtgggc      1740
     atttaatcca taagagtcaa tgtttatcgt tatcactgtg tgtaaattag acctttatcc      1800
     aacattaaga gagctaatca tatattatct agtgaaactt ggattctttc ctgcaaaatg      1860
     ggaccaagca aggatactgt tctgtgttgt atagagaaat atacacctcc acagaccatc      1920
     ccgtgagaat tggccatctt agcatgaaga tcaagaagga gggttttttt aactgctttg      1980
     taagaaaatg gaaaaaagtc aataaagata tatttcttta gaaaatgaga aaaaaaaaaa      2040
     aaaaaaaaaa a                                                           2051
//