spacer

EBI Dbfetch

ID   AY250220; SV 1; linear; mRNA; STD; MUS; 1263 BP.
XX
AC   AY250220;
XX
DT   20-DEC-2003 (Rel. 78, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus nogo receptor-like 3 (Ngrl3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1263
RX   DOI; 10.1016/S1044-7431(03)00199-4.
RX   PUBMED; 14664809.
RA   Lauren J., Airaksinen M.S., Saarma M., Timmusk T.;
RT   "Two novel mammalian Nogo receptor homologs differentially expressed in the
RT   central and peripheral nervous systems";
RL   Mol. Cell. Neurosci. 24(3):581-594(2003).
XX
RN   [2]
RP   1-1263
RA   Lauren J., Airaksinen M.S., Saarma M., Timmusk T.;
RT   ;
RL   Submitted (07-MAR-2003) to the INSDC.
RL   Institute of Biotechnology, University of Helsinki, Viikinkaari 9, Helsinki
RL   00014, Finland
XX
DR   MD5; 7db2bd3f83bd50267ff61f006420b1c9.
DR   Ensembl-Gn; ENSMUSG00000050896; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151799; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1263
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2E1"
FT                   /strain="C57b"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1263
FT                   /gene="Ngrl3"
FT   CDS             1..1263
FT                   /codon_start=1
FT                   /gene="Ngrl3"
FT                   /product="nogo receptor-like 3"
FT                   /note="putative GPI-linked membrane protein"
FT                   /db_xref="GOA:Q7M6Z0"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:2669796"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7M6Z0"
FT                   /protein_id="AAP82837.1"
FT                   /translation="MLPGLRRLLQGPASACLLLTLLALPSVTPSCPMLCTCYSSPPTVS
FT                   CQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIHPGTFRH
FT                   LQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQ
FT                   ENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAA
FT                   FHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARV
FT                   SSSDVTCATPPERQGRDLRALRDSDFQACPPPTPTRPGSRARGNSSSNHLYGVAEAGAP
FT                   PADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPADSRGP
FT                   ALSAGLRTPLLCLLPLALHHL"
XX
SQ   Sequence 1263 BP; 181 A; 511 C; 358 G; 213 T; 0 other;
     atgctgcccg ggctccggcg cctgctgcaa ggtcctgcct cagcctgcct actgctgaca        60
     ctcctggccc ttccttccgt gacccccagc tgtcctatgc tctgcacctg ctactcctcc       120
     ccgcccaccg tgagctgcca ggccaacaac ttctcctcag tgccgctgtc cttgccaccc       180
     agtacacaga gactcttctt gcagaacaac ctcatccgct cactgcggcc aggcaccttt       240
     gggcccaacc tgctcaccct gtggctcttc tccaacaacc tctccaccat ccaccctggc       300
     accttccgcc acctgcaggc cctagaagaa ctggacctcg gtgacaaccg gcacctgcgc       360
     tccctggagc ccgacacctt ccagggtctg gagaggctgc agtcactaca cctgtatcgt       420
     tgccagctca gcagcctgcc tggcaacatt ttccgaggct tggtcagcct acagtacctc       480
     tacctccagg agaacagcct gctccatcta caggatgact tgttcgcgga cctggccaac       540
     ctgagccacc tcttcctcca cgggaaccgc ctgcggctgc tcacggagca cgtgttccgc       600
     ggcttgggca gcctggaccg gctgttgctg cacgggaacc ggctgcaggg cgtgcaccgc       660
     gcggctttcc acggcctcag ccgcctcacc atcctctacc tgttcaacaa cagcctggcc       720
     tcgctgccgg gagaggcgct ggccgacctg ccggcgctcg agttcctgcg gctcaacgcc       780
     aacccctggg cgtgcgactg ccgcgctcgg ccgctctggg cttggttcca gcgcgcgcgg       840
     gtgtccagct ccgacgtgac ctgcgccacc ccgcccgagc gccagggccg ggacctgcgc       900
     gcgctgcgcg actccgattt ccaagcgtgc ccgccgccca cgcccacgcg gccgggcagc       960
     cgcgcccgcg gcaacagctc ttccaaccac ctgtacggcg tggccgaggc tggcgctccc      1020
     cccgcagacc cgtccacgct ctaccgagat ctgcccgccg aggactcgcg ggggcgccag      1080
     ggcggggacg cgcccaccga ggacgactac tgggggggct acggcggcga ggatcagcgg      1140
     ggcgagcaga cgtgtcccgg ggccgcgtgc caggcgcccg cagactcgcg tggccccgcg      1200
     ctctcggccg ggctgcgcac ccctctgctc tgcctcttgc ccctggcgct ccatcacctc      1260
     tga                                                                    1263
//


spacer
spacer