spacer

EBI Dbfetch

ID   AY243585; SV 1; linear; mRNA; STD; MUS; 1769 BP.
XX
AC   AY243585;
XX
DT   02-JUL-2003 (Rel. 76, Created)
DT   18-NOV-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus strain 129S1/SvImJ peroxisome proliferator-activated receptor
DE   gamma transcript 2 (Pparg) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RC   Publication Status: Online-Only
RP   1-1769
RX   PUBMED; 12837957.
RA   Lyons M.A., Wittenburg H., Li R., Walsh K.A., Leonard M.R., Churchill G.A.,
RA   Carey M.C., Paigen B.;
RT   "New quantitative trait loci that contribute to cholesterol gallstone
RT   formation detected in an intercross of CAST/Ei and 129S1/SvImJ inbred
RT   mice";
RL   Physiol. Genomics 14(3):225-239(2003).
XX
RN   [2]
RP   1-1769
RA   Lyons M.A., Wittenburg H., Walsh K.A., Carey M.C., Paigen B.;
RT   ;
RL   Submitted (25-FEB-2003) to the INSDC.
RL   The Jackson Laboratory, 600 Main Street, Bar Harbor, ME 04609, USA
XX
DR   MD5; 7c8e9cfb3985762f1e02e6b87e81a2d6.
DR   Ensembl-Gn; ENSMUSG00000000440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000450; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1769
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="52.7 cM"
FT                   /strain="129S1/SvImJ"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   gene            1..1769
FT                   /gene="Pparg"
FT   CDS             46..1563
FT                   /codon_start=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   transcript 2"
FT                   /note="ligand-activated transcription factor; Nr1c3"
FT                   /db_xref="GOA:Q6GU14"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GU14"
FT                   /protein_id="AAP42200.1"
FT                   /translation="MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGI
FT                   SSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQS
FT                   AIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFF
FT                   RRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLL
FT                   AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMN
FT                   SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLN
FT                   DQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFA
FT                   VKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ
FT                   LFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY"
XX
SQ   Sequence 1769 BP; 520 A; 414 C; 386 G; 449 T; 0 other;
     caaaacacca gtgtgaatta cagcaaatct ctgttttatg ctgttatggg tgaaactctg        60
     ggagattctc ctgttgaccc agagcatggt gccttcgctg atgcactgcc tatgagcact       120
     tcacaagaaa ttaccatggt tgacacagag atgccattct ggcccaccaa cttcggaatc       180
     agctctgtgg acctctccgt gatggaagac cactcgcatt cctttgacat caagcccttt       240
     accacagttg atttctccag catttctgct ccacactatg aagacattcc attcacaaga       300
     gctgacccaa tggttgctga ttacaaatat gacctgaagc tccaagaata ccaaagtgcg       360
     atcaaagtag aacctgcatc tccaccttat tattctgaaa agacccagct ctacaacagg       420
     cctcatgaag aaccttctaa ctccctcatg gccattgagt gccgagtctg tggggataaa       480
     gcatcaggct tccactatgg agttcatgct tgtgaaggat gcaagggttt tttccgaaga       540
     accatccgat tgaagcttat ttatgatagg tgtgatctta actgccggat ccacaaaaaa       600
     agtagaaata aatgtcagta ctgtcggttt cagaagtgcc ttgctgtggg gatgtctcac       660
     aatgccatca ggtttgggcg gatgccacag gccgagaagg agaagctgtt ggcggagatc       720
     tccagtgata tcgaccagct gaacccagag tctgctgatc tgcgagccct ggcaaagcat       780
     ttgtatgact catacataaa gtccttcccg ctgaccaaag ccaaggcgag ggcgatcttg       840
     acaggaaaga caacggacaa atcaccattt gtcatctacg acatgaattc cttaatgatg       900
     ggagaagata aaatcaagtt caaacatatc acccccctgc aggagcagag caaagaggtg       960
     gccatccgaa tttttcaagg gtgccagttt cgatccgtag aagccgtgca agagatcaca      1020
     gagtatgcca aaaatatccc tggtttcatt aaccttgatt tgaatgacca agtgactctg      1080
     ctcaagtatg gtgtccatga gatcatctac acgatgctgg cctccctgat gaataaagat      1140
     ggagtcctca tctcagaggg ccaaggattc atgaccaggg agttcctcaa aagcctgcgg      1200
     aagccctttg gtgactttat ggagcctaag tttgagtttg ctgtgaagtt caatgcactg      1260
     gaattagatg acagtgactt ggctatattt atagctgtca ttattctcag tggagaccgc      1320
     ccaggcttgc tgaacgtgaa gcccatcgag gacatccaag acaacctgct gcaggccctg      1380
     gaactgcagc tcaagctgaa tcacccagag tcctctcagc tgttcgccaa ggtgctccag      1440
     aagatgacag acctcaggca gatcgtcaca gagcacgtgc agctactgca tgtgatcaag      1500
     aagacagaga cagacatgag ccttcacccc ctgctccagg agatctacaa ggacttgtat      1560
     tagcaggaaa gtcccacccg ctgacaacgt gttccttcta ttgattgcac tattattttg      1620
     agggaaaaaa atctgacacc taagaaattt actgtgaaaa agcatttaaa aacaaaaagt      1680
     tttagaacat gatctatttt atgcatattg tttataaaga tacatttaca atttactttt      1740
     aatattaaaa attaccacat tataaaatt                                        1769
//


spacer
spacer