spacer

EBI Dbfetch

ID   AY230204; SV 1; linear; mRNA; STD; MUS; 1432 BP.
XX
AC   AY230204;
XX
DT   03-JUN-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus glycine receptor alpha 3 subunit (Glra3) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1432
RA   Haverkamp S., Mueller U., Harvey K., Harvey R.J., Betz H., Waessle H.;
RT   "Diversity of glycine receptors in the mouse retina: Localization of the
RT   alpha 3 subunit";
RL   Unpublished.
XX
RN   [2]
RP   1-1432
RA   Harvey R.J., Harvey K.;
RT   ;
RL   Submitted (05-FEB-2003) to the INSDC.
RL   Pharmacology, The School of Pharmacy, 29-39 Brunswick Square, London WC1N
RL   1AX, United Kingdom
XX
DR   MD5; 3a39d40d54b4717fdaf8e5f7252cc13f.
DR   Ensembl-Gn; ENSMUSG00000038257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000275; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1432
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1432
FT                   /gene="Glra3"
FT   CDS             19..1413
FT                   /codon_start=1
FT                   /gene="Glra3"
FT                   /product="glycine receptor alpha 3 subunit"
FT                   /note="ligand-gated chloride channel; neurotransmitter
FT                   receptor subunit"
FT                   /db_xref="GOA:Q91XP5"
FT                   /db_xref="InterPro:IPR006028"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008127"
FT                   /db_xref="InterPro:IPR008130"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95749"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XP5"
FT                   /protein_id="AAP22967.1"
FT                   /translation="MAHVRHFRTLVSGFYFWEAALLLSLVATKETNSARSRSAPMSPSD
FT                   FLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFGSIAETTMDYRVNIFLRQKWNDP
FT                   RLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSI
FT                   RLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLL
FT                   KEEKDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDA
FT                   APARVALGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFV
FT                   SRQHKELLRFRRKRKNKTEAFALEKFYRFSDTDDEVRESRFSFTAYGMGPCLQAKDGVV
FT                   PKGPNHAVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVIYKILRHED
FT                   IHQQQD"
XX
SQ   Sequence 1432 BP; 402 A; 321 C; 321 G; 388 T; 0 other;
     ggaactcttc tccatatcat ggcccacgtg agacactttc ggacactagt ttctggattt        60
     tacttctggg aagccgcact gttactgagt ttggtggcca caaaggaaac aaacagtgcg       120
     cgatctcgaa gtgctccaat gtcaccttct gattttctgg acaaactaat ggggaggaca       180
     tcggggtatg atgcaagaat cagacccaac ttcaaaggtc ctccagttaa tgtcacatgc       240
     aacatattca taaacagctt tggctccatt gcagagacga ctatggatta cagagtaaac       300
     atttttcttc gtcagaagtg gaatgatcct cgtcttgcat acagtgaata tcctgacgat       360
     tcattagacc ttgacccgtc tatgttggat tccatttgga aacctgactt gttctttgct       420
     aatgagaagg gggctaactt ccacgaagtc accacagata acaagctgct aagaattttc       480
     aaaaatggaa atgtccttta ttcaataagg ttgacattaa cactctcctg tccaatggat       540
     ctcaagaatt tcccaatgga tgtacaaaca tgcataatgc aacttgaaag ctttgggtac       600
     acaatgaatg atctcatttt tgaatggcaa gatgaagccc cagtacaagt ggctgaagga       660
     ctcactttgc ctcaatttct gttgaaagaa gaaaaggact tgcggtactg cactaaacac       720
     tacaatacag gaaagtttac atgcatagaa gtgcgattcc atcttgagcg tcagatgggc       780
     tattacttga tccagatgta catccccagc ctcctgatcg ttattctatc ctgggtctca       840
     ttctggatta acatggatgc agccccagct agagtagctt tgggcatcac cactgtactt       900
     actatgacca cacagagttc tggatcccgg gcctccttac caaaggtgtc atacgtcaag       960
     gctattgaca tttggatggc ggtgtgcctc ctttttgtgt tctcagcact tctggagtat      1020
     gcagccgtga attttgtctc aaggcaacac aaggagctgt tgaggtttcg gcgaaagaga      1080
     aagaataaga cggaagcttt tgcactggag aagttttacc gtttctcaga cacggatgat      1140
     gaggtgaggg agagtcgatt cagcttcact gcctatggaa tggggccctg tctgcaagcc      1200
     aaggatggtg tggttccaaa aggccccaac cacgctgtcc aggtcatgcc aaagagccct      1260
     gatgaaatga ggaaggtctt catcgacagg gctaagaaga ttgacaccat ctcccgagcc      1320
     tgctttccgc tagcattcct gatttttaac attttctact gggttatcta taaaatcctt      1380
     aggcatgaag acattcatca gcagcaagac taagtctctg aaggcataca aa              1432
//


spacer
spacer