spacer

EBI Dbfetch

ID   AY227797; SV 1; linear; mRNA; STD; MUS; 1056 BP.
XX
AC   AY227797;
XX
DT   30-MAR-2003 (Rel. 75, Created)
DT   30-MAR-2003 (Rel. 75, Last updated, Version 1)
XX
DE   Mus musculus CXC chemokine receptor1-like protein mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1056
RA   Xiong S.S., Hickey G.E., Humphrey J.E.;
RT   ;
RL   Submitted (30-JAN-2003) to the INSDC.
RL   Molecular Biology, R&D Systems, Inc., 614 McKinley Place NE, Minneapolis,
RL   MN 55413, USA
XX
DR   MD5; 2f0ec6ee576138047ace9ccea6013a8d.
DR   Ensembl-Gn; ENSMUSG00000048480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053389; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190313; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1056
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1056
FT                   /codon_start=1
FT                   /product="CXC chemokine receptor1-like protein"
FT                   /note="7 transmembrane receptor"
FT                   /db_xref="GOA:Q810W6"
FT                   /db_xref="InterPro:IPR000174"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR001355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2448715"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810W6"
FT                   /protein_id="AAO72727.1"
FT                   /translation="MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQ
FT                   ALVVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSK
FT                   LKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCV
FT                   GIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLT
FT                   MLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDT
FT                   CERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRR
FT                   VAFHTSLTAIY"
XX
SQ   Sequence 1056 BP; 211 A; 281 C; 245 G; 319 T; 0 other;
     atggccgagg ctgaatattt catctggact aatcctgagg gtgactttga gaaagaattt        60
     ggaaatatca cgggaatgct gcccactgga gattatttca tcccctgtaa gagagttcca       120
     ataaccaaca ggcaggcttt agttgtcttt tatgcactgg tgtcccttct gagcttgctg       180
     ggaaactcgc tggtgatgct ggttatctta tacaggcgaa ggacccgatc cgtcatggat       240
     gtctacgtgc tgaacctagc catcgccgac ctactctttt cattgaccct gcccttcttg       300
     gctgtctcca aattgaaggg ctggattttt ggcacacccc tgtgcaagat ggtctcactc       360
     ctgaaggaat tcaacttctt cagtggtatc ctgctgctgg cctgcatcag tgtggaccga       420
     tacctggcca tcgtccatgc cacccgtacg ctggcccgaa agcgctactt ggttaaattc       480
     gtgtgcgtgg gcatctgggg tctatctttg attctgtctc tgccttttgc tatcttccgc       540
     caggcatata aaccattccg ttctggtaca gtctgctatg aagtcctggg tgaagccaca       600
     acagattttc ggatgacctt gcggggtctg tcccacatat ttggcttcct cctgccgctg       660
     ctcactatgc tggtctgcta cgggctcaca ctgcgcatgc tctttaagac ccacatgagg       720
     cagaaacacc gggccatggg ggtgatcttt gctgttgtgt tggtcttctt gctctgttgt       780
     ctgccctaca atctggttct gctctcagac actctcttag gagcccactt gattgaagat       840
     acttgcgaac gccgcaatga cattgaccag gccctgtata ttactgagat cctgggcttt       900
     tctcatagtt gtcttaaccc tatcatctat gccttcgttg gccaaaattt tcgccatgaa       960
     ttcctcaaga tccttgctaa ccatggcctg gttcgcaagg aggttttgac acaccgccgt      1020
     gttgcctttc atacgtctct caccgctatt tattaa                                1056
//


spacer
spacer