spacer

EBI Dbfetch

ID   AY227027; SV 1; linear; mRNA; STD; MUS; 229 BP.
XX
AC   AY227027;
XX
DT   30-MAR-2003 (Rel. 75, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Mus musculus strain CD-1 neuregulin 1-beta 1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-229
RX   DOI; 10.1016/j.pep.2003.12.012.
RX   PUBMED; 15039062.
RA   Mautino B., Dalla Costa L., Gambarotta G., Perroteau I., Fasolo A.,
RA   Dati C.;
RT   "Bioactive recombinant neuregulin-1, -2, and -3 expressed in Escherichia
RT   coli";
RL   Protein Expr. Purif. 35(1):25-31(2004).
XX
RN   [2]
RP   1-229
RA   Mautino B., Dalla Costa L., Dati C.;
RT   ;
RL   Submitted (29-JAN-2003) to the INSDC.
RL   Animal and Human Biology, University of Turin, via Accademia Albertina, 13,
RL   Torino 10123, Italy
XX
DR   MD5; db68ece8cdb30c803806e26ab9588f5b.
DR   Ensembl-Gn; ENSMUSG00000062991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073884; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..229
FT                   /organism="Mus musculus"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /tissue_type="olfactory bulb"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>229
FT                   /codon_start=1
FT                   /product="neuregulin 1-beta 1"
FT                   /note="growth factor; NRG1-beta1"
FT                   /db_xref="GOA:Q810X0"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="MGI:MGI:96083"
FT                   /db_xref="UniProtKB/TrEMBL:Q810X0"
FT                   /protein_id="AAO72524.1"
FT                   /translation="STSTSTTGTSHLIKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKC
FT                   PNEFTGDRCQNYVMASFYKHLGIEFMEAEEL"
XX
SQ   Sequence 229 BP; 65 A; 51 C; 58 G; 55 T; 0 other;
     tccacatcta catccacgac tgggaccagc catctcataa agtgtgcgga gaaggagaaa        60
     actttctgtg tgaacggagg cgagtgcttc atggtgaagg acctgtcaaa cccctcaaga       120
     tacttgtgca agtgcccaaa tgagtttact ggtgatcgtt gccaaaacta cgtaatggcc       180
     agcttctaca agcatcttgg gattgaattt atggaagcgg aggaactct                   229
//


spacer
spacer