Dbfetch

ID   AY225520; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY225520;
XX
DT   29-MAR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1301 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Rodriguez-Marino S., Coquillard G.J.;
RT   "Novel HLA-DRB1*1301 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Rodriguez-Marino S., Coquillard G.J.;
RT   ;
RL   Submitted (27-JAN-2003) to the INSDC.
RL   HLA Typing Lab, Childrens Memorial Hospital, 2300 Childrens Plaza, Chicago,
RL   IL 60614, USA
XX
DR   MD5; a7327d7747434b184c22d309f09dd762.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:69"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAO67727.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 270 BP; 58 A; 64 C; 97 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//