spacer

EBI Dbfetch

ID   AY214167; SV 1; linear; genomic DNA; STD; HUM; 7240 BP.
XX
AC   AY214167;
XX
DT   19-JAN-2003 (Rel. 74, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens tumor necrosis factor (TNF superfamily, member 2) (TNF) gene,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-7240
RA   Rieder M.J., Livingston R.J., Daniels M.R., Montoya M.A., Chung M.-W.,
RA   Miyamoto K.E., Nguyen C.P., Nguyen D.A., Poel C.L., Robertson P.D.,
RA   Schackwitz W.S., Sherwood J.K., Witrak L.A., Nickerson D.A.;
RT   ;
RL   Submitted (08-JAN-2003) to the INSDC.
RL   Genome Sciences, University of Washington, 1705 NE Pacific, Seattle, WA
RL   98195, USA
XX
DR   MD5; 3dda3f3fd5ef17db104f79868b664ae7.
DR   EPD; EP11158; HS_TNF.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
XX
CC   To cite this work please use:  NIEHS-SNPs, Environmental Genome
CC   Project, NIEHS ES15478, Department of Genome Sciences, Seattle, WA
CC   (URL: http://egp.gs.washington.edu).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..7240
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   variation       238
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       247
FT                   /replace="a"
FT                   /frequency=".01"
FT   variation       542
FT                   /replace="t"
FT                   /frequency=".02"
FT   variation       707
FT                   /replace="c"
FT                   /frequency=".24"
FT   variation       876
FT                   /replace="a"
FT                   /frequency=".15"
FT   variation       877
FT                   /replace=""
FT                   /frequency=".99"
FT   variation       882
FT                   /replace="t"
FT                   /frequency=".11"
FT   variation       933
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       980
FT                   /replace="a"
FT                   /frequency=".01"
FT   variation       1093
FT                   /replace="a"
FT                   /frequency=".01"
FT   variation       1167
FT                   /replace="c"
FT                   /frequency=".01"
FT   variation       1169
FT                   /replace="a"
FT                   /frequency=".01"
FT   variation       1228
FT                   /replace="g"
FT                   /frequency=".01"
FT   variation       1363
FT                   /replace="a"
FT                   /frequency=".02"
FT   variation       1431
FT                   /replace="a"
FT                   /frequency=".09"
FT   variation       1495
FT                   /replace="a"
FT                   /frequency=".02"
FT   variation       1501
FT                   /replace="a"
FT                   /frequency=".08"
FT   variation       1748
FT                   /replace="t"
FT                   /frequency=".01"
FT   mRNA            join(1750..2105,2718..2763,2951..2998,3300..4519)
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT   variation       1812
FT                   /gene="TNF"
FT                   /replace=""
FT                   /frequency=".99"
FT   CDS             join(1920..2105,2718..2763,2951..2998,3300..3721)
FT                   /codon_start=1
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAO21132.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   variation       2006
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       2226
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       2228
FT                   /gene="TNF"
FT                   /replace="a"
FT                   /frequency=".12"
FT   repeat_region   2299..2340
FT                   /rpt_family="L2"
FT                   /rpt_type=DISPERSED
FT   variation       2369..2372
FT                   /gene="TNF"
FT                   /replace=""
FT                   /frequency=".99"
FT   variation       2432
FT                   /gene="TNF"
FT                   /replace=""
FT                   /frequency=".01"
FT   variation       2475..2476
FT                   /gene="TNF"
FT                   /replace=""
FT                   /frequency=".98"
FT   repeat_region   2534..2583
FT                   /rpt_family="L2"
FT                   /rpt_type=DISPERSED
FT   variation       2969
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       3049
FT                   /gene="TNF"
FT                   /replace="g"
FT                   /frequency=".08"
FT   variation       3059
FT                   /gene="TNF"
FT                   /replace="a"
FT                   /frequency=".01"
FT   variation       3955
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       4174
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       4902
FT                   /replace="c"
FT                   /frequency=".06"
FT   repeat_region   4903..5078
FT                   /rpt_family="MIR"
FT                   /rpt_type=DISPERSED
FT   variation       5169
FT                   /replace="a"
FT                   /frequency=".01"
FT   repeat_region   5174..5310
FT                   /rpt_family="Alu"
FT                   /rpt_type=DISPERSED
FT   variation       5196
FT                   /replace="c"
FT                   /frequency=".04"
FT   variation       5257
FT                   /replace="a"
FT                   /frequency=".04"
FT   variation       5387
FT                   /replace="a"
FT                   /frequency=".03"
FT   repeat_region   5473..5777
FT                   /rpt_family="Alu"
FT                   /rpt_type=DISPERSED
FT   variation       5522
FT                   /replace="a"
FT                   /frequency=".04"
FT   variation       5827
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       5867
FT                   /replace="a"
FT                   /frequency=".02"
FT   variation       5881
FT                   /replace="a"
FT                   /frequency=".03"
FT   variation       6018
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       6673
FT                   /replace="c"
FT                   /frequency=".01"
FT   variation       6775
FT                   /replace="c"
FT                   /frequency=".01"
FT   variation       6858
FT                   /replace="g"
FT                   /frequency=".01"
FT   variation       6935
FT                   /replace="a"
FT                   /frequency=".01"
XX
SQ   Sequence 7240 BP; 1821 A; 1886 C; 2010 G; 1523 T; 0 other;
     ctgctgatag tcccggagct ttcaagaagg attctttcct cccaggggac cacacctccc        60
     tgaatatccc tgatgtctgt ctggctgagg atttcaagcc tgcctaggaa ttcccagccc       120
     aaagctgttg gtctgtccca ccagctaggt ggggcctaga tccacacaca gaggaagagc       180
     aggcacatgg aggagcttgg gggatgacta gaggcaggga ggggactatt tatgaaggca       240
     aaaaaattaa attatttatt tatggaggat ggagagaggg gaataataga agaacatcca       300
     aggagaaaca gagacaggcc caagagatga agagtgagag ggcatgcgca caaggctgac       360
     caagagagaa agaagtaggc atgagggatc acagggcccc agaaggcagg gaaaggctct       420
     gaaagccagc tgccgaccag agccccacac ggaggcatct gcaccctcga tgaagcccaa       480
     taaacctctt ttctctgaaa tgctgtctgc ttgtgtgtgt gtgtctggga gtgagaactt       540
     cccagtctat ctaaggaatg gagggaggga cagagggctc aaagggagca agagctgtgg       600
     ggagaacaaa aggataaggg ctcagagagc ttcagggata tgtgatggac tcaccaggtg       660
     aggccgccag actgctgcag gggaagcaaa ggagaagctg agaagatgaa ggaaaagtca       720
     gggtctggag gggcgggggt cagggagctc ctgggagata tggccacatg tagcggctct       780
     gaggaatggg ttacaggaga cctctgggga gatgtgacca cagcaatggg taggagaatg       840
     tccagggcta tggaagtcga gtatggggac ccccccctta acgaagacag ggccatgtag       900
     agggccccag ggagtgaaag agcctccagg acctccaggt atggaataca ggggacgttt       960
     aagaagatat ggccacacac tggggccctg agaagtgaga gcttcatgaa aaaaatcagg      1020
     gaccccagag ttccttggaa gccaagactg aaaccagcat tatgagtctc cgggtcagaa      1080
     tgaaagaaga aggcctgccc cagtggggtc tgtgaattcc cgggggtgat ttcactcccc      1140
     ggggctgtcc caggcttgtc cctgctaccc ccacccagcc tttcctgagg cctcaagcct      1200
     gccaccaagc ccccagctcc ttctccccgc agggacccaa acacaggcct caggactcaa      1260
     cacagctttt ccctccaacc ccgttttctc tccctcaagg actcagcttt ctgaagcccc      1320
     tcccagttct agttctatct ttttcctgca tcctgtctgg aagttagaag gaaacagacc      1380
     acagacctgg tccccaaaag aaatggaggc aataggtttt gaggggcatg gggacggggt      1440
     tcagcctcca gggtcctaca cacaaatcag tcagtggccc agaagacccc cctcggaatc      1500
     ggagcaggga ggatggggag tgtgaggggt atccttgatg cttgtgtgtc cccaactttc      1560
     caaatccccg cccccgcgat ggagaagaaa ccgagacaga aggtgcaggg cccactaccg      1620
     cttcctccag atgagctcat gggtttctcc accaaggaag ttttccgctg gttgaatgat      1680
     tctttccccg ccctcctctc gccccaggga catataaagg cagttgttgg cacacccagc      1740
     cagcagacgc tccctcagca aggacagcag aggaccagct aagagggaga gaagcaacta      1800
     cagacccccc cctgaaaaca accctcagac gccacatccc ctgacaagct gccaggcagg      1860
     ttctcttcct ctcacatact gacccacggc tccaccctct ctcccctgga aaggacacca      1920
     tgagcactga aagcatgatc cgggacgtgg agctggccga ggaggcgctc cccaagaaga      1980
     caggggggcc ccagggctcc aggcggtgct tgttcctcag cctcttctcc ttcctgatcg      2040
     tggcaggcgc caccacgctc ttctgcctgc tgcactttgg agtgatcggc ccccagaggg      2100
     aagaggtgag tgcctggcca gccttcatcc actctcccac ccaaggggaa atggagacgc      2160
     aagagaggga gagagatggg atgggtgaaa gatgtgcgct gatagggagg gatggagaga      2220
     aaaaaacgtg gagaaagacg gggatgcaga aagagatgtg gcaagagatg gggaagagag      2280
     agagagaaag atggagagac aggatgtctg gcacatggaa ggtgctcact aagtgtgtat      2340
     ggagtgaatg aatgaatgaa tgaatgaatg aacaagcaga tatataaata agatatggag      2400
     acagatgtgg ggtgtgagaa gagagatggg ggaagaaaca agtgatatga ataaagatgg      2460
     tgagacagaa agagagcggg aaatatgaca gctaaggaga gagatggggg agataaggag      2520
     agaagaagat agggtgtctg gcacacagaa gacactcagg gaaagagctg ttgaatgcct      2580
     ggaaggtgaa tacacagatg aatggagaga gaaaaccaga cacctcaggg ctaagagcgc      2640
     aggccagaca ggcagccagc tgttcctcct ttaagggtga ctccctcgat gttaaccatt      2700
     ctccttctcc ccaacagttc cccagggacc tctctctaat cagccctctg gcccaggcag      2760
     tcagtaagtg tctccaaacc tctttcctaa ttctgggttt gggtttgggg gtagggttag      2820
     taccggtatg gaagcagtgg gggaaattta aagttttggt cttgggggag gatggatgga      2880
     ggtgaaagta ggggggtatt ttctaggaag tttaagggtc tcagcttttt cttttctctc      2940
     tcctcttcag gatcatcttc tcgaaccccg agtgacaagc ctgtagccca tgttgtaggt      3000
     aagagctctg aggatgtgtc ttggaacttg gagggctagg atttggggat tgaagcccgg      3060
     ctgatggtag gcagaacttg gagacaatgt gagaaggact cgctgagctc aagggaaggg      3120
     tggaggaaca gcacaggcct tagtgggata ctcagaacgt catggccagg tgggatgtgg      3180
     gatgacagac agagaggaca ggaaccggat gtggggtggg cagagctcga gggccaggat      3240
     gtggagagtg aaccgacatg gccacactga ctctcctctc cctctctccc tccctccagc      3300
     aaaccctcaa gctgaggggc agctccagtg gctgaaccgc cgggccaatg ccctcctggc      3360
     caatggcgtg gagctgagag ataaccagct ggtggtgcca tcagagggcc tgtacctcat      3420
     ctactcccag gtcctcttca agggccaagg ctgcccctcc acccatgtgc tcctcaccca      3480
     caccatcagc cgcatcgccg tctcctacca gaccaaggtc aacctcctct ctgccatcaa      3540
     gagcccctgc cagagggaga ccccagaggg ggctgaggcc aagccctggt atgagcccat      3600
     ctatctggga ggggtcttcc agctggagaa gggtgaccga ctcagcgctg agatcaatcg      3660
     gcccgactat ctcgactttg ccgagtctgg gcaggtctac tttgggatca ttgccctgtg      3720
     aggaggacga acatccaacc ttcccaaacg cctcccctgc cccaatccct ttattacccc      3780
     ctccttcaga caccctcaac ctcttctggc tcaaaaagag aattgggggc ttagggtcgg      3840
     aacccaagct tagaacttta agcaacaaga ccaccacttc gaaacctggg attcaggaat      3900
     gtgtggcctg cacagtgaag tgctggcaac cactaagaat tcaaactggg gcctccagaa      3960
     ctcactgggg cctacagctt tgatccctga catctggaat ctggagacca gggagccttt      4020
     ggttctggcc agaatgctgc aggacttgag aagacctcac ctagaaattg acacaagtgg      4080
     accttaggcc ttcctctctc cagatgtttc cagacttcct tgagacacgg agcccagccc      4140
     tccccatgga gccagctccc tctatttatg tttgcacttg tgattattta ttatttattt      4200
     attatttatt tatttacaga tgaatgtatt tatttgggag accggggtat cctgggggac      4260
     ccaatgtagg agctgccttg gctcagacat gttttccgtg aaaacggagc tgaacaatag      4320
     gctgttccca tgtagccccc tggcctctgt gccttctttt gattatgttt tttaaaatat      4380
     ttatctgatt aagttgtcta aacaatgctg atttggtgac caactgtcac tcattgctga      4440
     gcctctgctc cccaggggag ttgtgtctgt aatcgcccta ctattcagtg gcgagaaata      4500
     aagtttgctt agaaaagaaa catggtctcc ttcttggaat taattctgca tctgcctctt      4560
     cttgtgggtg ggaagaagct ccctaagtcc tctctccaca ggctttaaga tccctcggac      4620
     ccagtcccat ccttagactc ctagggccct ggagacccta cataaacaaa gcccaacaga      4680
     atattcccca tcccccagga aacaagagcc tgaacctaat tacctctccc tcagggcatg      4740
     ggaatttcca actctgggaa ttccaatcct tgctgggaaa atcctgcagc tcaggtgaga      4800
     tttccggctg ttgcagctgg ccagcagtcc ggagagagct ggagaggagc cgcattctca      4860
     ggtacctgaa tcacacagcc aagggacttc cagagattcg ggtgtctagg cttcaaatca      4920
     ccctgtccta actctgcaac ctgaaccagc cacttaacct atctatccaa tggggatagg      4980
     aatgtccacc acacataggg catgtgagag aaggcctgac ctccatcaga ggacctcact      5040
     cagcccttgg cacagtgggc acttagtgaa ttctggcttc cttcaaccag tttccagctg      5100
     ttctatcccc ttccattctc tcagtgggtg aaatcgaaga gactgaggac aataaagaac      5160
     aaggaaccga actgccggac gtggtggcat gcacctgtaa tcctaccact ttgcaaggcc      5220
     aaggtgagag gatcgcttga acccaggagt tccagagcaa cctgggcaac atagtgagat      5280
     cctgtctcta ttttttaaaa aagaatgaaa cataggaata agatgtgggt gaaggactca      5340
     catgccggct tggtcccact ggtctttgtg gtgaaggagg ggagaggtga gaggtgggta      5400
     atccggaaag agaaaagcac cccctccctg gatgaaggct cttctggaga gagtcaaaga      5460
     caaataaggg tggggcgcag tggctcatgc ctgttatccc aacactttgg gaggctgagg      5520
     tgggaggacc acttgagccc actagttcaa gaccagcctg tgcaacatag caagaccttg      5580
     tttctagaaa aaaaattaaa gattagtcag gtgtagtggt gcatgcctgt aatcctagct      5640
     cctcaggagg ctgaggcagg aggatcactc aagcccagga gtttgaggtt acagtaagct      5700
     atgatcatgc cactgtaccc ccgtctgggt gacagaacga gaccctgtct caaaaaaata      5760
     ataattccaa aaacaaatat ggagacggaa attgagcccc cctagactgg gagcccccac      5820
     tgagttcgga aattaggctt tacctccagc cctggggtgc caggcaggag aaaaccatgt      5880
     ggtaggctga gggggtaggg tgacccattg gggtgaccta gatagggcct tgggtcaccc      5940
     tctgcctcct ccagcctgtg gctgaaagtc agccatgaag taatggggga cactgttact      6000
     catcccagaa gcacccacac ttactcactt ttgggaaggg ggacctaaag tgtgaaaaaa      6060
     aggtgaggat tttccgtctc accctaaatg ggacacccta agtggggcat cggtttttcc      6120
     tcctccccag aacttcctgg tgttttcagg caccacaggc tccttcctgc catccccatc      6180
     tctctctaat attctcccct tctttctcct tcagcctcct cccttcagac cccatgagcc      6240
     ttgaattaag ctccttggag gagaagagtt gactgtcggg taggagacag agaggccttc      6300
     aggcagctct agggggagaa gtgcggggcc cctccaggct tcattcctct gtcatgatag      6360
     gggcttactc tgctgctggg cctttctgag tggtgcttgc tgggctctgt aatgacccct      6420
     ctcactgttg gggggtaccc aagagaaaag agtatggtgc agagtctggt tgggaccatg      6480
     tggccctgaa aatcaggatg cctagagaag cttcggagtt tgagaagtcc cccttcctcc      6540
     caccctccaa ctgggctaat ggtggggcct ggccattcag aggcagggag ggggtgggac      6600
     aggcagacca tcatccctag gagcaaaggc catacactgt gttgtgatga attgtttcaa      6660
     gcaaccagaa gagtactgag aatatttaac ccgcacccgt gcacccaccc tgaattaaga      6720
     cgtgtgtcgc aactcagcat ctttatcggc agcactgaag ctttccattc tttattttca      6780
     tcaggttcaa aatcaatttc caaacagtct cctacatttt tcccactgcc atggggtcct      6840
     gggcgtccgg gcccccaata ttcacgcact cgcaccacgc actcatattc cctcacccca      6900
     ccatcacggc cccaaagaag gtcttccctc tcgcgaagtc caccatatcg gggtgactga      6960
     tgttgacgta caccctctcg cccctccgga gctgcaccag gccgccgaac cccacgctcg      7020
     tgtaccagag aggcccgtac ccttgtctcc tggccgggtc cagcactgga gtcaccgtct      7080
     cggcgccctc gagcagcagc tcgggagtgc ccggcccgta ggcgcccccc gcccggtaca      7140
     gagagctgcg cagcgtgacc gagcggccct gggggtcccc gccgccaggg ggcgcccggc      7200
     cccggtagcc gacgagacag tagaggtaat agaggccgtc                            7240
//


spacer
spacer