spacer

EBI Dbfetch

ID   AY208183; SV 1; linear; mRNA; STD; MUS; 1768 BP.
XX
AC   AY208183;
XX
DT   02-JUL-2003 (Rel. 76, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus strain CAST/Ei peroxisome proliferator-activated receptor
DE   gamma isoform 2 (Pparg) mRNA, complete cds; alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1768
RX   DOI; 10.1194/jlr.M300002-JLR200.
RX   PUBMED; 12588951.
RA   Lyons M.A., Wittenburg H., Li R., Walsh K.A., Churchill G.A., Carey M.C.,
RA   Paigen B.;
RT   "Quantitative trait loci that determine lipoprotein cholesterol levels in
RT   DBA/2J and CAST/Ei inbred mice";
RL   J. Lipid Res. 44(5):953-967(2003).
XX
RN   [2]
RP   1-1768
RA   Lyons M.A., Wittenburg H., Walsh K.A., Carey M.C., Paigen B.;
RT   ;
RL   Submitted (27-DEC-2002) to the INSDC.
RL   The Jackson Laboratory, 600 Main Street, Bar Harbor, ME 04609, USA
XX
DR   MD5; 47cf4bc8d1d86c99c245b882762f7153.
DR   Ensembl-Gn; ENSMUSG00000000440; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000450; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1768
FT                   /organism="Mus musculus"
FT                   /chromosome="6"
FT                   /map="52.7"
FT                   /strain="CAST/Ei"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="liver"
FT                   /db_xref="taxon:10090"
FT   gene            1..1768
FT                   /gene="Pparg"
FT                   /note="Pparg2; similar to GenBank Accession Numbers
FT                   AY236532-AY236537"
FT   CDS             46..1563
FT                   /codon_start=1
FT                   /gene="Pparg"
FT                   /product="peroxisome proliferator-activated receptor gamma
FT                   isoform 2"
FT                   /note="ligand-activated nuclear transcription factor;
FT                   alternatively spliced"
FT                   /db_xref="GOA:Q6GU14"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003074"
FT                   /db_xref="InterPro:IPR003077"
FT                   /db_xref="InterPro:IPR008946"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR022590"
FT                   /db_xref="MGI:MGI:97747"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GU14"
FT                   /protein_id="AAO45097.1"
FT                   /translation="MGETLGDSPVDPEHGAFADALPMSTSQEITMVDTEMPFWPTNFGI
FT                   SSVDLSVMEDHSHSFDIKPFTTVDFSSISAPHYEDIPFTRADPMVADYKYDLKLQEYQS
FT                   AIKVEPASPPYYSEKTQLYNRPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFF
FT                   RRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLL
FT                   AEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMN
FT                   SLMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKNIPGFINLDLN
FT                   DQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFA
FT                   VKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQ
FT                   LFAKVLQKMTDLRQIVTEHVQLLHVIKKTETDMSLHPLLQEIYKDLY"
XX
SQ   Sequence 1768 BP; 519 A; 415 C; 386 G; 448 T; 0 other;
     caaaacacca gtgtgaatta cagcaaatct ctgttttatg ctgttatggg tgaaactctg        60
     ggagattctc ctgttgaccc agagcatggt gccttcgctg atgcactgcc tatgagcact       120
     tcacaagaaa ttaccatggt tgacacagag atgccattct ggcccaccaa cttcggaatc       180
     agctctgtgg acctctccgt gatggaagac cactcgcatt cctttgacat caagcccttt       240
     accacagttg atttctccag catttctgct ccacactatg aagacattcc attcacaaga       300
     gctgacccaa tggttgctga ttacaaatat gacctgaagc tccaagaata ccaaagtgcg       360
     atcaaagtag aacctgcatc tccaccttat tattctgaaa agacccagct ctacaacagg       420
     cctcatgaag aaccttctaa ctccctcatg gccattgagt gccgagtctg tggggataaa       480
     gcatcaggct tccactatgg agttcatgct tgtgaaggat gcaagggttt tttccgaaga       540
     actatccgat tgaagcttat ttatgatagg tgtgatctta actgccggat ccacaaaaaa       600
     agtagaaata aatgtcagta ctgtcggttt cagaagtgcc ttgctgtggg gatgtctcac       660
     aatgccatca ggtttgggcg gatgccacag gccgagaagg agaagctgtt ggcggagatc       720
     tccagtgata tcgaccagct gaacccagag tctgctgatc tgcgagccct ggcaaagcat       780
     ttgtatgact catacataaa gtccttcccg ctgaccaaag ccaaggcgag ggcgatcttg       840
     acaggaaaga caacggacaa atcaccattt gtcatctacg acatgaattc cttaatgatg       900
     ggagaagata aaatcaagtt caaacatatc acccccctgc aggagcagag caaagaggtg       960
     gccatccgaa tttttcaagg gtgccagttt cgatccgtag aagccgtgca agagatcaca      1020
     gagtatgcca aaaatatccc tggtttcatt aaccttgact tgaatgacca agtgactctg      1080
     ctcaagtatg gtgtccatga gatcatctac acgatgctgg cctccctgat gaataaagat      1140
     ggagtcctca tctcagaggg ccaaggattc atgaccaggg agttcctcaa aagcctgcgg      1200
     aagccctttg gtgactttat ggagcctaag tttgagtttg ctgtgaagtt caatgcactg      1260
     gaattagatg acagtgactt ggctatattt atagctgtca ttattctcag tggagaccgc      1320
     ccaggcttgc tgaacgtgaa gcccatcgag gacatccaag acaacctgct gcaggccctg      1380
     gaactgcagc tcaagctgaa ccacccagag tcctctcagc tgttcgccaa ggtgctccag      1440
     aagatgacag acctcaggca gatcgtcaca gagcacgtgc agctactgca tgtgatcaag      1500
     aagacagaga cagacatgag ccttcacccc ctgctccagg agatctacaa ggacttgtat      1560
     tagcaggaaa gtcccacccg ctgacaacgt gttccttcta ttgattgcac tattattttg      1620
     agggaaaaaa tctgacacct aagaaattta ctgtgaaaaa gcatttaaaa acaaaaagtt      1680
     ttagaacatg atctatttta tgcatattgt ttataaagat acatttacaa tttactttta      1740
     atattaaaaa ttaccacatt ataaaatt                                         1768
//


spacer
spacer