spacer

EBI Dbfetch

ID   AY185605; SV 1; linear; mRNA; STD; MUS; 1881 BP.
XX
AC   AY185605;
XX
DT   18-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus EGF containing fibulin-like extracellular matrix protein 1
DE   (Efemp1) mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1881
RX   DOI; 10.1016/S1567-133X(03)00084-X.
RX   PUBMED; 12915309.
RA   Ehlermann J., Weber S., Pfisterer P., Schorle H.;
RT   "Cloning, expression and characterization of the murine Efemp1, a gene
RT   mutated in Doyne-Honeycomb retinal dystrophy";
RL   Brain Res. Gene Expr. Patterns 3(4):441-447(2003).
XX
RN   [2]
RP   1-1881
RA   Schorle H., Pfisterer P., Ehlermann J., Weber S.;
RT   ;
RL   Submitted (21-NOV-2002) to the INSDC.
RL   Developmental Pathology, Pathology, Sigmund Freud Strasse 25, Bonn 53127,
RL   Germany
XX
DR   MD5; 826cc8687003341de4fef9e2f249eefc.
DR   Ensembl-Gn; ENSMUSG00000020467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020759; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1881
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11A4"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..1881
FT                   /gene="Efemp1"
FT   CDS             <1..1436
FT                   /codon_start=3
FT                   /gene="Efemp1"
FT                   /product="EGF containing fibulin-like extracellular matrix
FT                   protein 1"
FT                   /db_xref="GOA:Q8BPB5"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR026823"
FT                   /db_xref="MGI:MGI:1339998"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BPB5"
FT                   /protein_id="AAO37642.1"
FT                   /translation="SQYTEETITYTQCTDGYEWDPIRQQCKDIDECDIVPDACKGGMKC
FT                   VNHYGGYLCLPKTAQIIVNNEHPQQETPAAEASSGATTGTVAARSMATSGVVPGGGFMA
FT                   SATAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTS
FT                   GTHNCRTDQVCINLRGSFTCQCLPGYQKRGEQCVDIDECTVPPYCHQRCVNTPGSFYCQ
FT                   CSPGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDE
FT                   CRTSSYLCQYQCVNEPGKFSCMCPQGYEVVRSRTCQDINECETTNECREDEMCWNYHGG
FT                   FRCYPRNPCQDHYVLTSENRCVCPVSNTMCRELPQSIVYKYMSIRSDRSVPSDIFQIQA
FT                   TMIYANTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKSLSGPREYIVDLEMLTVSSIG
FT                   TFRTSSVLRLTIIVGPFSF"
XX
SQ   Sequence 1881 BP; 596 A; 405 C; 403 G; 477 T; 0 other;
     agtcacagta caccgaggaa accatcacat acacgcaatg caccgatgga tatgaatggg        60
     accccataag acagcagtgt aaagatattg atgaatgtga cattgtccca gatgcttgca       120
     aaggtggaat gaaatgtgtc aaccactatg gaggatatct ctgccttcct aaaacagccc       180
     aaattattgt caataatgag catcctcagc aagaaacacc agctgcagaa gcttcgtcag       240
     gtgccaccac tgggactgta gctgccagga gcatggcaac cagtggtgtg gtgcctgggg       300
     gtggcttcat ggccagtgct actgcagttg ctggccctga agttcaaact ggccgaaata       360
     actttgtcat ccgaagaaac ccagctgacc ctcagcgcat cccttccaac ccttcccacc       420
     ggatccagtg tgcagcaggc tatgaacaga gtgagcataa tgtgtgccaa gatattgatg       480
     agtgcacctc agggactcac aattgtagaa cggaccaagt atgcatcaat ttacgaggtt       540
     ccttcacatg tcagtgtctt cctgggtatc agaagcgagg tgaacagtgt gtggatatag       600
     atgaatgcac agtgcctcca tattgccacc aaagatgtgt taacacacct ggttccttct       660
     actgccagtg cagtccaggg tttcagctgg cagcaaacaa ctacacttgt gtggatataa       720
     atgaatgtga tgccagcaac cagtgtgctc aacaatgcta caacattctt ggctcattca       780
     tctgtcagtg taatcaagga tatgaactaa gcagtgacag actcaactgt gaagacatcg       840
     acgaatgcag aacctcaagc tacctatgcc aatatcaatg tgtcaatgaa cctgggaagt       900
     tctcatgtat gtgcccacag ggttacgaag tggtgcgcag cagaacctgt caggatataa       960
     atgaatgtga gaccaccaat gaatgccgag aagatgagat gtgctggaat taccatgggg      1020
     gcttccgctg ttacccacga aacccatgtc aagatcacta tgttctaaca tcagaaaacc      1080
     gatgtgtttg cccagtctca aacactatgt gccgggagct gccccagtcc attgtctaca      1140
     aatacatgag catccgatct gacaggtccg tgccttcaga catcttccag atacaggcaa      1200
     caatgattta tgcaaacacc attaatactt ttcggattaa atctggaaat gaaaatggag      1260
     agttctacct acgacaaaca agccctgtga gtgcaatgct ggtgcttgtg aagtctctat      1320
     caggaccaag agaatacatc gtggacctgg agatgctgac agtcagtagt ataggaacct      1380
     tccgcacaag ctctgtgtta agattgacaa taatagtggg gccattttca ttttagcctt      1440
     ttactcatat aaagcctact acaagcattt aaatcagcca aacaatatca ttaccttaaa      1500
     actctatttt atttatagct atatctagta catgtatatt caaatagcta gactatggta      1560
     agaagtgggc atttaatcca taagagtcaa tgtttatcgt tatcactgtg tgtaaattag      1620
     acctttatcc aacattaaga gagctaatca tatattatct agtgaaactt ggattctttc      1680
     ctgcaaaatg ggaccaagca aggatactgt tctgtgttgt atagagaaat atacacctcc      1740
     acagaccatc ccgtgagaat tggccatctt agcatgaaga tcaagaagga gggttttttt      1800
     aactgctttg taagaaaatg gaaaaaagtc aataaagata tatttcttta gaaaatgaga      1860
     aaaaaaaaaa aaaaaaaaaa a                                                1881
//


spacer
spacer