spacer

EBI Dbfetch

ID   AY179366; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AY179366;
XX
DT   22-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1313 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Lo B.;
RT   "Confirmatory Sequence for HLA Class II DRB1*1313";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Lo B.;
RT   ;
RL   Submitted (13-NOV-2002) to the INSDC.
RL   Stanford Histocompatibility Laboratory, Stanford Medical School Blood
RL   Center, 800 Welch Road, Palo Alto, CA 94304, USA
XX
DR   MD5; 0461ae1073b0ac77ae4c7961c189e618.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="VI"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:55"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAO23237.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVT
FT                   ELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 266 BP; 56 A; 63 C; 95 G; 52 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tagcgccgag tactggaaca gccagaagga       180
     cttcctggaa gacaggcggg ccctggtgga cacctactgc agacacaact acggggttgg       240
     tgagagcttc acggtgcagc ggcgag                                            266
//


spacer
spacer