spacer

EBI Dbfetch

ID   AY178845; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AY178845;
XX
DT   14-JAN-2003 (Rel. 74, Created)
DT   14-JUL-2009 (Rel. 101, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*13 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.0001-2815.2004.00226.x.
RX   PUBMED; 15140048.
RA   Testa G.V., Bunce M., Sheldon M.H., Dunn P.P., Day S., Marques S.B.;
RT   "Identification of a new allele, HLA-DRB1*1360, on a DRB5 haplotype in a
RT   Brazilian individual";
RL   Tissue Antigens 63(6):617-618(2004).
XX
RN   [2]
RP   1-270
RA   Marques S.B.D., Testa G.V.;
RT   "Identification of a DRB1*13 variant in a Brazillian family";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Marques S.B.D., Testa G.V.;
RT   ;
RL   Submitted (12-NOV-2002) to the INSDC.
RL   Histocompatibility Laboratory, UNICAMP, Rua Carlos Chagas 480, Campinas, SP
RL   13081-970, Brazil
XX
DR   MD5; 98ab14c93952cd4247f2da5843b6e987.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:60"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="AAO18733.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*13 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 67 C; 96 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtccgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer