spacer

EBI Dbfetch

ID   AY178834; SV 2; linear; genomic DNA; STD; MUS; 5410 BP.
XX
AC   AY178834;
XX
DT   10-NOV-2003 (Rel. 77, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 3)
XX
DE   Mus musculus strain NZB interleukin-four induced gene-1 protein (Il4i1)
DE   gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5410
RA   Chu C.C., Kim J.A., Gupta N., Yuen G.J., Thomas R.R., George J., Hsueh K.;
RT   "Interleukin-four induced gene-1 polymorphisms correlate with Sle3
RT   autoimmune susceptibility";
RL   Unpublished.
XX
RN   [2]
RP   1-5410
RA   Chu C.C., Kim J.A., Gupta N., Yuen G.J., Thomas R.R., George J., Hsueh K.;
RT   ;
RL   Submitted (14-NOV-2002) to the INSDC.
RL   Department of Medicine / NSLIJ Research Institute, North Shore University
RL   Hospital / NYU School of Medicine, 350 Community Drive, Manhasset, NY
RL   11030, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-5410
RA   Chu C.C., Kim J.A., Gupta N., Yuen G.J., Thomas R.R., George J., Hsueh K.;
RT   ;
RL   Submitted (21-NOV-2003) to the INSDC.
RL   Department of Medicine / NSLIJ Research Institute, North Shore University
RL   Hospital / NYU School of Medicine, 350 Community Drive, Manhasset, NY
RL   11030, USA
XX
DR   MD5; 867abc5a70d2606586e704cc3b595644.
DR   Ensembl-Gn; ENSMUSG00000074141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033015; mus_musculus.
XX
CC   On Nov 21, 2003 this sequence version replaced gi:37695559.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5410
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="NZB"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            590..5106
FT                   /gene="Il4i1"
FT                   /note="synonym: Fig1"
FT   mRNA            join(590..619,807..840,934..1169,1679..1791,2292..2493,
FT                   3453..3521,3626..3762,3885..5106)
FT                   /gene="Il4i1"
FT                   /product="interleukin-four induced gene-1 protein"
FT   5'UTR           join(590..619,807..827)
FT                   /gene="Il4i1"
FT   exon            590..619
FT                   /gene="Il4i1"
FT                   /number=1
FT   exon            807..840
FT                   /gene="Il4i1"
FT                   /number=2
FT   CDS             join(828..840,934..1169,1679..1791,2292..2493,3453..3521,
FT                   3626..3762,3885..5007)
FT                   /codon_start=1
FT                   /gene="Il4i1"
FT                   /product="interleukin-four induced gene-1 protein"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAO65453.1"
FT                   /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTLKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   exon            934..1169
FT                   /gene="Il4i1"
FT                   /number=3
FT   exon            1679..1791
FT                   /gene="Il4i1"
FT                   /number=4
FT   exon            2292..2493
FT                   /gene="Il4i1"
FT                   /number=5
FT   exon            3453..3521
FT                   /gene="Il4i1"
FT                   /number=6
FT   exon            3626..3762
FT                   /gene="Il4i1"
FT                   /number=7
FT   exon            3885..5106
FT                   /gene="Il4i1"
FT                   /number=8
FT   3'UTR           5008..5106
FT                   /gene="Il4i1"
FT   polyA_signal    5086..5091
FT                   /gene="Il4i1"
XX
SQ   Sequence 5410 BP; 1208 A; 1550 C; 1522 G; 1130 T; 0 other;
     cagttttggc agaggcttct agggtcattt ctctgaggtg tcagtctaga gtctgctgcc        60
     cagcagtact taagacaaag caggaaggac aaaggacaag tggccactta gccatcacca       120
     accagtcctg cccatgttcc tgcagctgca gcaaacaggt tctggacctg gccaggtgct       180
     atatgcaggc cctgacctgg ctccattcct gccattgtgc tggaccatgt gacatgagta       240
     ggccaatatg ggcttcaaat gtgaaaggcc ccagacttgt gtgtgcccat ttcatacaga       300
     cattcttgga gagatgggga ggggatgggc agacccaaga caaaagtcca agaaagagca       360
     cagggtccac catcaacact gccacctggg tgggtagtcc ccacccccag cttccccaaa       420
     gctatttgaa gcaggaagaa gaaaaataga ctgagttact tcctcctgtg atatttattc       480
     ccatcacctc ccccagcatc tgaccctagc tcaggaaagc acttttaatt cccgagggag       540
     gtgagtgggc ggggctggct acttttaagg ggagagtcgc agaggctctg ctctgcagtc       600
     ctgcccaaga gagctgaagg tagagctaca tggagggtgg tggcaacgac tggaacccag       660
     aacccaaggc tggaaagcag gaggggaggg agccaggcca taatggtcaa gattaggtct       720
     ggggaaatac atgcccagag aggaaggagg gagacaggct ggggatccct ggccccacca       780
     cattgacccc ctacttcttc actcagacag cagctgccac ttgagccatg gctgggctgg       840
     gtaagtgagc agccaagagg aggagggagt gctggggtta cggctgactc ctgcacttct       900
     ggtgcctatg tgctgaccct gtccttttgc cagccctgcg tcttgtcctg gcggccaccc       960
     tccttggtct ggcaggctct ctggactgga aggcagcctc cagcttgaac cctattgaga      1020
     agtgtatgga ggaccacgat tatgagcagc tactcaaggt ggtgaccttg ggcctcaatc      1080
     ggactttgaa gccccagaag gtggtagtgg ttggtgcagg cgtggcaggg ctggtagcag      1140
     ccaagatgct cagtgatgca ggacacaagg tgagaagtgc tgcctgtagt cctcagggag      1200
     cctttcctgc tgctggtggg gagtcctggg tagtgtgacg gagagaagct accctttcct      1260
     agagccccca tttcattgac ccactgcact ccacttaccc gtcctggagg gaaggcctac      1320
     ttcctcttct taatgtaatt gtcaagagtt gagatgggga tttggaggta aggggcctga      1380
     gaaatcctca agggagagta tccctcacct aaccctagga atgagattgg gccagcccca      1440
     actcttctgt acaaactagg aaatccccct cttcctgcct taagctggga agtccctcta      1500
     cagtccatct gctagtcctc ctgctacagt cttgagacct ttctttccga gcagcccctc      1560
     ctacccagaa gaaaggccct tctattctag gtgtccttta ctattggggg caagacaggc      1620
     aggggctagt gggaatgtag tgagggagct gaggtccctg ttggccgctt ttctttaggt      1680
     caccatcctg gaggcagata acaggattgg gggccgtatc ttcactttcc gggatgagaa      1740
     gacaggctgg ataggggagc ttggggccat gcgaatgccc agctctcaca ggtgaggtcc      1800
     cacctaacca ggcagcagag ccccacctct gcaccaaggt ttagccagag cccagttcca      1860
     tacccactcc cacattctgc caactcccgt cccagattca ggctcagcca atcccagcct      1920
     cattcttggt ctgggctcaa ccagaagcaa gctctatccc cagtccaggc accagtatct      1980
     gtgttttgag gtgctgctta tagaactttg ggcttcaagc tacacctcca actcatctcc      2040
     agtttcaccc ctattcccac ccagtcaaaa gttgggtcta gaccttactt ccactcacac      2100
     ccctcagtac tgccttccgg agagcccggg tgatcagtgc cctagcctgc aagctgcctg      2160
     agctctgccc ctatccccac cccgactcct gagccagccc tcaggtcccc agtgagtagt      2220
     ctgatgccca tctccagtgg ccctcttatg gtgccaggcc aggcctctct caagcagcct      2280
     cccacttcta ggatcttgca caagctctgc aggaccctgg gcctcaacct gactcagttc      2340
     acacagtatg atgagaacac gtggacggag gtgcataatg tgaagctgcg aaactatgtg      2400
     gtggagaaga tgccagaaaa gctgggctac aacctgaaca acagggaaag gggccattcc      2460
     ccagaggaca tctaccagat ggcactcaac aaggtggcca ccggctttcc tgcagagctc      2520
     agccctgccc ccaagagtct tgtgtctact actatcacgt ctgctgatgg ctagcgggtg      2580
     ttttctccat ccctccagct cacccactac tgtagcccct ggcactcaat cccaggaccc      2640
     tccagcaaca ctgctactct gtgtccccat ctgcttgact cggacagtgc tgtcagacat      2700
     caccctcttt tcgtgtccca aaaggatctt tccatccaga tgaccctgcc tacaactcca      2760
     tgtacctccc cagtgcctct caggcccatg agccagacca gctttccctc tccttagtcc      2820
     acctggtgat ccaggcatac cctcctctgc tcctggaacc caaccttcct catccatcac      2880
     ccctaagtct gtatcctcga cttccacctt acccatgaca aggaggtcta ggtaaagagg      2940
     ctggaggcca tgtttggaag gagctcaaag atcactaaat gccaggctgg agagcctgca      3000
     tatagcaggg gaggcagccc tgctctctat actttagaac tacaactgcc ttctgcaaga      3060
     aagggtaacg gaggcagctg gtccttgggg gccagtagag gtgggactct agtggttcct      3120
     cctgggggtg ggggtgggga gctaagggaa gttgtgggtg aggggggaca ctactgaata      3180
     gtctttgctg gtagtatcat cctcttggac tgtgagaggc cctcacctgc ctatgcccac      3240
     aatggtctag acaatgatct ctactggctc gccctcactg gcctgcacaa aaacacacac      3300
     tactgctgac tgggtggaca gacagggaaa cccagtattt ggaggactcc cgcttcagag      3360
     caggtgtatg catcatgagc taatgcctgg gacctgaagt gaggtgaatt gctgttcctg      3420
     ctgcaacaag ggtcctctga ttgtccccac aggccttcaa agacctcaag gccttgggct      3480
     gcaagaaagc catgaataag ttcaacaagc atacgcttct ggtgagtgag gcaaggtgat      3540
     ttccctcttc tgtcacaaga gatagttgtg atacagggct cagcaggaaa ggaaggtctg      3600
     attagtgccc ctgcccactg cacaggaata cctcctcgag gagggcaacc tgtcccggcc      3660
     agctgtgcag ctcctgggag atgtgatgtc cgaggagggc ttcttctacc tcagctttgc      3720
     agaagcctta cgcgcgcacg cctgcctgag cgatcgactc cggtgagggc acaacggatg      3780
     gggcaagcca caaggcgggg catcctggga gggacagggc cacaggggac agggccttaa      3840
     gagttggggt cagtgtgccc gcccttcttt gccccgccct gtaggtacag ccgcatcgta      3900
     ggtggctggg acctgcttcc gcgagctctg ctgagctcac tgtccggggc gctgctactg      3960
     aacgcgcctg tggtgtcgat cactcagggg aggaacgatg tgcgcgtgca cattgccacc      4020
     tcgcttcaca gcgagaagac gctgacagcc gacgtggtgc tgctgactgc cagtggaccc      4080
     gcgctgcagc gcattacctt ctcgccgccc ttgactcgca agaggcagga ggcactgcgc      4140
     gcgcttcact acgtagcagc cagcaaggtt tttctgagtt tccgtcggcc cttctggcac      4200
     gaggagcaca tcgagggcgg ccactccaac actgaccgcc catcgcgcct catattctat      4260
     cccgcgcggg gcgagggctc actgcttctg gcctcctaca cgtggtcgga cgctgcagcc      4320
     cccttcgctg gactgagcac cgaccagacc ctgcgtttgg tgctccagga cgtggcggcc      4380
     ctgcacgggc ctgtggtgtt ccggctgtgg gacggcaggg gtgtggtcaa gcgctgggca      4440
     gaggacccgc atagccaggg aggcttcgtg gtgcagccgc cattgtacgg gcgcgaggct      4500
     gaggactatg actggtcagc ccccttcggc cgcatttact tcgcgggcga gcacacagct      4560
     ctcccgcatg gctgggtaga gaccgctgtc aagtccgggt tgcgggccgc ggtgagaatc      4620
     aataataact atgggtacgg ggaggtcgac ccccagatga tggagcatgc atatgcagag      4680
     gccaactatc tggaccagta tcctgaaggg gagaggcccg aggagcagca ggcgcgggaa      4740
     gaagtcagcc cagatgaaca ggagccctct cacaaacact tgttggtgga aacgagcccc      4800
     gaggggcagc aacacgcgtt tgtggaggcc attcccgagc tgcagggaca cgtgttcgtg      4860
     gagactgtcc cccaggagaa ggggcacgcc caccagaata tatatccttc ggagcatgta      4920
     caggtgcatg gggaagtcat ccctgagtgg catggtcatg ggggatctgg caccccgcaa      4980
     atgcaccgag tgggggacca ctcctaatcg caaagaggaa gtgagcaccc agctcctaag      5040
     ccagccctct tcagggcaga cagaccacct acactaatag cccacaataa agttattttt      5100
     gttaaaccac aggctcactt ccctccacaa tgcactggtt tccagaatat aactgcccta      5160
     ggtggggcga cacttgagtg aatgaacact acaccgtggt gaagagatca gaagccattg      5220
     gatgctgggg tgctgacaga tcctgactgg aacaaaaacc cagcaacctt gaggccagca      5280
     tgggctatga gcaagatggg aaaagcaaag tgtcctgatg ccagccagcg cagtcaacca      5340
     agaacggttt attgcctcac aatggcagca gctggtgggc gggcactcgg gaatcccgga      5400
     cctctaggag                                                             5410
//


spacer
spacer