spacer

EBI Dbfetch

ID   AY174092; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AY174092;
XX
DT   16-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA) gene, HLA-DRB1*1425 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Vayntrub T., Lo B.;
RT   "HLA Class II DRB1*1425 Confirmatory Sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Vayntrub T., Lo B.;
RT   ;
RL   Submitted (06-NOV-2002) to the INSDC.
RL   Stanford Histocompatibility Laboratory, Stanford Medical School Blood
RL   Center, 800 Welch Road, Palo Alto, CA 94304, USA
XX
DR   MD5; 800676d665462f1e9f2cbac948f68318.
DR   Ensembl-Gn; ENSG00000196126; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228080; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000360004; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000412634; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000419393; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /gene="HLA"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9GIY3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*14:25"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9GIY3"
FT                   /protein_id="AAO20089.1"
FT                   /translation="FLEYSTSECHFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAVT
FT                   ELGRPAAEHWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 266 BP; 56 A; 63 C; 96 G; 51 T; 0 other;
     tttcttggag tactctacgt ctgagtgtca tttcttcaat gggacggagc gggtgcggtt        60
     cctggacaga tacttctata accaagagga gtacgtgcgc ttcgacagcg acgtggggga       120
     gtaccgggcg gtgacggagc tggggcggcc tgctgcggag cactggaaca gccagaagga       180
     cttcctggaa gacaggcggg ccgcggtgga cacctactgc agacacaact acggggttgg       240
     tgagagcttc acagtgcagc ggcgag                                            266
//


spacer
spacer