Dbfetch

ID   AY174091; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AY174091;
XX
DT   16-JAN-2003 (Rel. 74, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA) gene, HLA-DRB1*120201 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Lo B.;
RT   "HLA Class II DRB1*120201 Confirmatory Sequence";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Lo B.;
RT   ;
RL   Submitted (06-NOV-2002) to the INSDC.
RL   Stanford Histocompatibility Laboratory, Stanford Medical School Blood
RL   Center, 800 Welch Road, Palo Alto, CA 94304, USA
XX
DR   MD5; 95368fb642b1d65ff846352f50311df9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>266
FT                   /codon_start=2
FT                   /gene="HLA"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IE3"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*12:02:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95IE3"
FT                   /protein_id="AAO20088.1"
FT                   /translation="FLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAVT
FT                   ELGRPVAESWNSQKDFLEDRRAAVDTYCRHNYGAVESFTVQRR"
XX
SQ   Sequence 266 BP; 53 A; 65 C; 97 G; 51 T; 0 other;
     tttcttggag tactctacgg gtgagtgtta tttcttcaat gggacggagc gggtgcggtt        60
     actggagaga cacttccata accaggagga gctcctgcgc ttcgacagcg acgtggggga       120
     gttccgggcg gtgacggagc tggggcggcc tgtcgccgag tcctggaaca gccagaagga       180
     cttcctggaa gacaggcgcg ccgcggtgga cacctattgc agacacaact acggggctgt       240
     ggagagcttc acagtgcagc ggcgag                                            266
//