spacer

EBI Dbfetch

ID   AY168407; SV 1; linear; mRNA; STD; MUS; 4694 BP.
XX
AC   AY168407;
XX
DT   27-DEC-2002 (Rel. 74, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus brain-specific angiogenesis inhibitor 2 (Bai2) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-4694
RX   DOI; 10.1097/00004647-200209000-00003.
RX   PUBMED; 12218411.
RA   Kee H.J., Koh J.T., Kim M.Y., Ahn K.Y., Kim J.K., Bae C.S., Park S.S.,
RA   Kim K.K.;
RT   "Expression of brain-specific angiogenesis inhibitor 2 (BAI2) in normal and
RT   ischemic brain: involvement of BAI2 in the ischemia-induced brain
RT   angiogenesis";
RL   J. Cereb. Blood Flow Metab. 22(9):1054-1067(2002).
XX
RN   [2]
RP   1-4694
RA   Kee H.J., Koh J.T., Kim K.K.;
RT   ;
RL   Submitted (24-OCT-2002) to the INSDC.
RL   Pharmacology, Chonnam National University Medical School, Hak-Dong 5,
RL   Dong-Ku, Kwangju 501-190, South Korea
XX
DR   MD5; 5836faa34dc1968393feb4ba6051ce78.
DR   Ensembl-Gn; ENSMUSG00000028782; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106017; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121049; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4694
FT                   /organism="Mus musculus"
FT                   /strain="ICR"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             2..4684
FT                   /codon_start=1
FT                   /gene="Bai2"
FT                   /product="brain-specific angiogenesis inhibitor 2"
FT                   /note="mBAI2"
FT                   /db_xref="GOA:Q8CGM1"
FT                   /db_xref="InterPro:IPR000203"
FT                   /db_xref="InterPro:IPR000832"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001879"
FT                   /db_xref="InterPro:IPR008077"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR022624"
FT                   /db_xref="MGI:MGI:2451244"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGM1"
FT                   /protein_id="AAN86965.1"
FT                   /translation="MTPACPLLLSVILSLRLATAFDPAPSACSALASGVLYGAFSLQDL
FT                   FPTIASGCSWTLENPDPTKYSLYLRFNRQEQVCTHFAPRLLPLDHYLVNFTCLRPGPEE
FT                   ATARAESEVGRLEEEEEAAAAASGLELCGGSGPFTFLHFDKNFVQLCLSAEPSEAPRLL
FT                   APAALAFRFVEVLLINNNNSSQFTCGVLCRWSEECGRAAGRACGFAQPGCSCPGEAGAN
FT                   PATTTSPGPPVAHTLSNALVPGGPAPPAEADLHSGSSNDLFTTEMRYGEEPEEEPKVKT
FT                   QWPRSADEPGLYMAQTGDPAAEEWSPWSVCSLTCGQGLQVRTRSCVSSPYGTLCSGPLR
FT                   ETRPCNNSATCPVHGVWEEWGSWSLCSRSCGRGSRSRMRTCVPPKHGGKACEGPELQTK
FT                   LCSMAACPVEGQWLEWGPWGPCSSSCANGTQQRSRKCSVAGPAWATCAGALTDTRECSN
FT                   LDCPATDGKWGPWNAWSLCSKTCDTGWQRRFRMCQASGTQGYPCEGTGEEVKPCSEKRC
FT                   PAFHEMCRDEYVMLMTWKRAAAGEIIYNKCPPNASGSASRRCLLSAQGVAYWGLPSFAR
FT                   CISHEYRYLYLSLREHLAKGQRMLAGEGMSQVVRSLQELLARRTYYSGDLLFSVDILRN
FT                   VTDTFKRATYVPSADDVQRFFQVVSFMVDSENKDKWDDAQQVSPGSVHLLRVVEDFIHL
FT                   VGDALKAFQSSLIVTDNLVISIQREPISAVSSDITFPMRGRRGMKDWVRHSEDRLFLPK
FT                   EVLSLSSPGKPATPGAATAGSPGRGRGPGTVPPGPGHAHQRLLPADPEESSSYFVIGAV
FT                   LYRTLGLILPPPRPPLAVTSRVMTVTVRPPTQPPAEPLITVELSYIINGTTDPHCASWD
FT                   YSRADTNSGDWNTESCQTLETQAAHTRCQCQHLSTFAVLAQPPKDLTLELAGAPSVPLV
FT                   IGCAVSCMALLTLLAIYAAFWRFIKSERSIILLNFCLSILASNILILVGQSRVLSKGVC
FT                   TMTAAFLHFFFLSSFCWVLTEAWQSYLAVIGRMRTRLVRKRFLCLGWGLPALVVAVSVG
FT                   FTRTKGYGTSSYCWLSLEGGLLYAFVGPAAVIVLVNMLIGIIVFNKLMARDGVSDKSKK
FT                   QRAGSERCPWASLLLPCSACGAVPSPLLSSASARNAMASLWSSCVVLPLLALTWMSAVL
FT                   AMTDRRSVLFQALFAVFNSAQGFVITAVHCFLRREVQDVVKCQMGVCRADESEDSPDSC
FT                   KNGQLQILSDFEKDVDLACQTVLFKEVNTCNPSTITGTLSRLSLDEDEEPKSCLVGPEG
FT                   GLSFSPLPGNILVPMAASPGLGEPPPPQETNPVYMCGEGGLRQLDLTWIRQSEPGSEGD
FT                   YMVLPRRTLSLQPGGGGTAGEEAPRARPEGTPRRAAKTVAHTEGYPSFLSVEHSGLGLG
FT                   PAYGSLQNPYGMTFQPPPPTPSARQVPEPGERSRTMPRTVPGSTMKLGSLERKKLRYSD
FT                   LDFEKVMHTRKRHSELYHELNQKFHTFDRYRSQSSAKEKPSPPGGRPGLSQHRRHQSWS
FT                   TFKSMTLGSLPPKPRERLALHRTAAWEPPEPPDGDFQTEV"
XX
SQ   Sequence 4694 BP; 844 A; 1508 C; 1401 G; 941 T; 0 other;
     gatgacccca gcctgtcccc tcttactgtc tgtgattctg tccctgcgcc tggccacggc        60
     cttcgaccct gcccccagtg cctgctctgc cctggcctcg ggcgtgctct acggggcctt       120
     ctcgctgcag gacctctttc ccaccatcgc ctcgggctgc tcctggaccc tggagaaccc       180
     agaccccacc aagtactccc tctacctgcg cttcaaccgg caggagcagg tttgcacaca       240
     ctttgccccg cgcctgctgc ccctggacca ctacctggtc aactttacct gcctgcggcc       300
     tggtccagag gaagccacag cccgggctga gtcggaggtg ggacggctgg aggaggagga       360
     ggaggcggcg gcagcagcat cggggttgga gttgtgtggt ggctcaggcc cctttacctt       420
     tctgcacttc gacaagaact ttgtgcagct gtgcctgtcg gctgagccct ctgaggcccc       480
     tcgtctgcta gcgcctgctg ccctggcctt ccgttttgtg gaggtcttgc tgatcaacaa       540
     caacaactcc agccagttca cctgtggtgt gctctgccgc tggagtgagg agtgtggccg       600
     ggctgcaggc agggcttgtg gctttgcaca gccagggtgt agctgtcctg gggaggcagg       660
     ggccaacccc gccaccacca catctccggg gcctccggtt gcccacaccc tgtccaatgc       720
     cctggtgccc gggggcccag cccctcctgc tgaggccgac ttgcactcgg ggagcagcaa       780
     tgacctgttc accacagaga tgagatatgg tgaggagccg gaagaggaac cgaaggtgaa       840
     aacccagtgg ccaaggtctg cagatgagcc tgggctatac atggcgcaga caggcgaccc       900
     agcagctgag gagtggtccc cgtggagcgt gtgttccctg acgtgtgggc agggtctgca       960
     ggtgcggacc cgctcctgcg tgtcctcccc ctatgggacc ctgtgcagcg ggccccttcg      1020
     ggagacccgg ccttgcaaca attcagccac ctgcccagtg cacggcgtgt gggaggagtg      1080
     ggggtcctgg agcctgtgct cccgcagctg cgggcggggg tctcggagcc ggatgcggac      1140
     ctgcgtgccc cccaagcacg gcggcaaggc ctgcgagggt cccgagctgc agactaaact      1200
     ctgcagtatg gccgcctgcc cggtggaagg ccagtggcta gaatggggtc cctggggccc      1260
     atgctcatca tcttgtgcca atgggaccca gcagcgcagc cggaaatgca gtgtggcggg      1320
     tccagcctgg gccacgtgcg caggtgccct cacggatacc cgtgagtgca gcaatctcga      1380
     ttgcccggcc actgacggca agtgggggcc gtggaacgcg tggagcctgt gctccaagac      1440
     gtgtgacacg ggctggcaac gccgcttccg catgtgccag gcttctggca cacagggcta      1500
     cccttgcgag ggcacaggag aggaggtgaa accctgcagt gagaagaggt gtccagcctt      1560
     ccatgagatg tgcagggatg agtacgtgat gttgatgaca tggaagaggg cggcagctgg      1620
     cgagatcatt tacaacaagt gtccccctaa tgcctcgggt tctgctagcc gccgctgtct      1680
     cctcagtgcc cagggcgtag catactgggg actgcccagc tttgctcgtt gcatatccca      1740
     tgaataccgc tacctgtacc tgtcacttcg ggaacacctg gctaagggcc agcgcatgct      1800
     ggcgggtgag ggcatgtcac aggtggtgcg gagcctgcag gagctactgg cacggcgcac      1860
     ttactacagc ggggacctgc tcttctctgt ggacatccta aggaacgtca ctgacacctt      1920
     caagagggcc acctatgtcc cttccgccga tgacgtgcag cgtttcttcc aggtggtgag      1980
     cttcatggtg gattcagaaa acaaggacaa atgggatgat gctcagcagg tgtcacccgg      2040
     ctctgtgcac ctgctgcgtg ttgtggaaga tttcattcac ctcgtgggcg acgctctcaa      2100
     ggccttccag agctctctca ttgtcacgga caatctggtg atcagcattc agagagagcc      2160
     tatctccgcc gtgtccagtg acatcacgtt tcccatgcgg ggccgcaggg gcatgaagga      2220
     ctgggtgcga cactcagagg atcgtctctt tctacccaag gaggtgctca gcctgtcctc      2280
     cccaggaaag ccagccacac ctggggcagc cacagcaggc agcccgggca gggggagggg      2340
     cccaggaacg gtgccccctg gcccaggcca cgcccaccag cgccttctcc cagctgaccc      2400
     cgaagagtcc tcctcctact ttgtgatcgg tgctgtgctc taccgcaccc ttggcctcat      2460
     cctgccgccc cccaggcctc cacttgctgt cacctcccgg gtgatgacag tgactgtgcg      2520
     tccccccacc cagcctccag ctgagcccct cattacagtg gaactctcgt acatcatcaa      2580
     tggcaccacc gatccccact gtgccagctg ggactactcc agagcagata ccaactcggg      2640
     ggactggaac actgagagct gccagacctt ggagacccag gcggctcaca cccgctgcca      2700
     gtgccagcac ctgtccacct ttgccgtcct ggcccagcca cccaaggacc tgaccctgga      2760
     gctggcaggt gctccctctg tccccctggt gatcggctgt gcggtgtcct gcatggctct      2820
     gctcacactg ctggccatct atgcagcctt ctggaggttt ataaaatcag aacgctccat      2880
     catcttgctg aacttctgcc tgtccatcct ggcttccaac attctgatcc tggtgggcca      2940
     gtcccgggtg ctgagcaagg gcgtatgcac catgacggct gccttcctac acttcttctt      3000
     tctgtcctcc ttttgctggg tgcttacaga ggcctggcaa tcctatctgg ctgtcatcgg      3060
     gcggatgcgc acccgcctgg ttcgcaagcg cttcctctgc ctgggctggg gtctacctgc      3120
     cctggtggtg gctgtgtctg ttggctttac tcgcaccaaa ggatatggta catccagcta      3180
     ctgctggctg tccctagagg gcggcctgct ctatgccttc gtgggtccag cagcagtcat      3240
     tgtcctggtg aacatgctca tcgggattat cgtcttcaac aagctcatgg ctcgcgatgg      3300
     tgtctcagac aaatctaaga agcagagggc tgggtcggag cggtgcccct gggccagcct      3360
     gctccttccc tgctcagcgt gtggagcggt ccccagcccc ctgctcagct cagcctcggc      3420
     caggaatgcc atggcttcac tctggagttc ctgcgtggta ctgcctctcc tggcgcttac      3480
     ctggatgtct gccgtcctgg ccatgacaga tcgccgctcc gtcctcttcc aggcactctt      3540
     tgccgttttc aactctgcac aaggctttgt catcaccgct gtgcactgct tcctgcgccg      3600
     agaggtccag gatgtggtaa agtgtcagat gggtgtgtgt cgggctgatg agagtgaaga      3660
     ctccccagac tcgtgcaaga atgggcagct gcagatcctg tcagactttg aaaaggacgt      3720
     ggatctggct tgtcagacag ttctgttcaa ggaggtcaac acctgcaacc cgtccaccat      3780
     taccggcact ctgtcccgcc tgtctctgga tgaggatgag gagcccaagt cctgtctcgt      3840
     gggtcctgag ggtggcctca gcttctcacc actgcctggg aacatcctgg tacccatggc      3900
     agcctcacca ggtctagggg agccaccacc accccaggag accaaccctg tgtacatgtg      3960
     tggggagggt ggccttcggc agttggacct tacatggata cggcagagtg aaccaggctc      4020
     tgagggggac tacatggttc tgccccggcg gactttgagc ctgcagcctg gtggtggggg      4080
     tacagcgggt gaggaggccc caagggcccg gcctgagggg accccccggc gggctgccaa      4140
     aacggtagcc cacactgaag gctaccccag cttcctgtct gtggagcact cgggtctagg      4200
     gctgggccct gcctatgggt ctctccagaa cccgtatgga atgaccttcc aaccaccacc      4260
     accaacaccc agcgcccgcc aagtaccaga gccaggagaa cgtagccgga ccatgccccg      4320
     tacagtgcct ggttccacca tgaagctggg ctcccttgag cgaaagaagc ttcggtattc      4380
     ggacttggac tttgagaagg tgatgcacac tcggaaacgg cactcggaac tctaccacga      4440
     actcaaccag aagttccaca ctttcgaccg ctaccgtagc cagtcctcag ccaaggagaa      4500
     acccagcccc cccgggggac gccctggctt gtcccagcac aggaggcatc aaagctggag      4560
     caccttcaaa tctatgacac tgggctcact gccccccaag ccccgagaac ggctggccct      4620
     gcaccggaca gcagcctggg agcccccaga accgccagac ggcgacttcc agacagaggt      4680
     gtgagtgcca cgcc                                                        4694
//


spacer
spacer