spacer

EBI Dbfetch

ID   AY161348; SV 1; linear; genomic DNA; STD; MUS; 5415 BP.
XX
AC   AY161348;
XX
DT   11-OCT-2003 (Rel. 77, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus strain MRL interleukin-four induced gene-1 protein (Il4i1)
DE   gene, exons 1 through 8 and complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5415
RA   Chu C.C., Kim J.A., Hsueh K.;
RT   "Interleukin-four induced gene-1 polymorphisms correlate with Sle3
RT   autoimmune susceptibility";
RL   Unpublished.
XX
RN   [2]
RP   1-5415
RA   Chu C.C., Kim J.A., Hsueh K.;
RT   ;
RL   Submitted (10-OCT-2002) to the INSDC.
RL   Department of Medicine / Research Institute, North Shore University
RL   Hospital / NYU School of Medicine, 350 Community Drive, Manhasset, NY
RL   11030, USA
XX
DR   MD5; dc26c4135369370815b5d28bcddb199f.
DR   Ensembl-Gn; ENSMUSG00000074141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033015; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5415
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="MRL"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            594..5111
FT                   /gene="Il4i1"
FT                   /note="synonym: Fig1"
FT   mRNA            join(594..623,811..844,938..1173,1683..1795,2296..2497,
FT                   3458..3526,3631..3767,3890..5111)
FT                   /gene="Il4i1"
FT                   /product="interleukin-four induced gene-1 protein"
FT   5'UTR           join(594..623,811..831)
FT                   /gene="Il4i1"
FT   exon            594..623
FT                   /gene="Il4i1"
FT                   /number=1
FT   exon            811..844
FT                   /gene="Il4i1"
FT                   /number=2
FT   CDS             join(832..844,938..1173,1683..1795,2296..2497,3458..3526,
FT                   3631..3767,3890..5012)
FT                   /codon_start=1
FT                   /gene="Il4i1"
FT                   /product="interleukin-four induced gene-1 protein"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAO23118.1"
FT                   /translation="MAGLALRLVLAATLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPAQGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQEPSHKHLLVETSPEGQQHAFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   exon            938..1173
FT                   /gene="Il4i1"
FT                   /number=3
FT   exon            1683..1795
FT                   /gene="Il4i1"
FT                   /number=4
FT   exon            2296..2497
FT                   /gene="Il4i1"
FT                   /number=5
FT   exon            3458..3526
FT                   /gene="Il4i1"
FT                   /number=6
FT   exon            3631..3767
FT                   /gene="Il4i1"
FT                   /number=7
FT   exon            3890..5111
FT                   /gene="Il4i1"
FT                   /number=8
FT   3'UTR           5013..5111
FT                   /gene="Il4i1"
FT   polyA_signal    5091..5096
FT                   /gene="Il4i1"
XX
SQ   Sequence 5415 BP; 1211 A; 1546 C; 1522 G; 1136 T; 0 other;
     cagttttggc agaggcttct agggtcattt ctctgaggtg tcagtctaga gtctgctgcc        60
     cagcagtact taagacaaag caggaaggac aaaggacaag tggccactta gccatcacca       120
     accagtcctg cccatgttcc tgcagctgca gcaaacaggt tctggacctg gccaggtgct       180
     atatgcaggc cctgacctgg ctccattcct gccattgtgc tggaccatgt gacatgagta       240
     ggcctatatg ggcttcaaat gtgaaaggcc ccagacttgt gtgtgcccat ttcatacaga       300
     cattcttgga gagatgggga ggggatgggc agacccaaga caaaagtcca agaagcctag       360
     agcacagggt ccaccatcaa cactgccacc tgggtgggta gtccccaccc ccagcttccc       420
     caaagctatt tgaagcagga agaagaaaaa tagactgagt tacttcctcc tgtgatattt       480
     attcccatca cctcccccag catctgaccc tagctcagga aagcactttt aattcccgag       540
     ggaggtgagt gggcggggct ggctactttt aaggggagag tcgcagaggc tctgctctgc       600
     agtcctgccc aagagagctg aaggtagagc tacatggagg gtggtggcaa tgactggaac       660
     ccagaaccca aggctggaaa gcaggagggg agggagccag gccataatgg tcaagattag       720
     gtctggggaa atacatgccc agagaggaag gagggagaca ggctggggat ccctggcccc       780
     accacattga ccccctactt cttcactcag acagcagctg ccacttgagc catggctggg       840
     ctgggtaagt gagcagccaa gaggaggagg gagtgctggg gttacggctg actcctgcac       900
     ttctggtgcc tatgtgctga ccctgtcctt ttgccagccc tgcgtcttgt cctggcggcc       960
     accctccttg gtctggcagg ctctctggac tggaaggcag cctccagctt gaaccctatt      1020
     gagaagtgta tggaggacca cgattatgag cagctactca aggtggtgac cttgggcctc      1080
     aatcggactt cgaagcccca gaaggtggta gtggttggtg caggcgtggc agggctggta      1140
     gcagccaaga tgctcagtga tgcaggacac aaggtgagaa gtgctgcctg tagtcctcag      1200
     ggagcctttc ctgctgctgg tggggagtcc tgggtagtgt gacggagaga agctaccctt      1260
     tcctagagcc cccatttcat tgacccactg cactccactt acccgtcctg gagggaaggc      1320
     ctacttcctc ttcttaatgt aactgtcaag agttgagatg gggatttgga ggtaaggggc      1380
     ctgagaaatc ctcaagggag agtatccctc acctaaccct aggaatgaga ttgggccagc      1440
     cccaactctt ctgtacaaac taggaaatcc ccctcttcct gccttaagct gggaagtccc      1500
     tctacagtcc atctgctagt cttcctgcta cagtcttgag acctttcttt ccgagcagcc      1560
     cctcctaccc agaagaaagg cccttctatt ctaggtgtcc tttactattg ggggcaagac      1620
     aggcaggggc tagtgggaat gtagtgaggg agctgaggtc cctgttggcc gcttttcttt      1680
     aggtcaccat cctggaggca gataacagga ttgggggccg tatcttcact ttccgggatg      1740
     agaagacagg ctggataggg gagcttgggg ccatgcgaat gcccagctct cacaggtgag      1800
     gtcccaccta cccaggcagc agagccccac ctctacacca aggtttagcc agagcccagt      1860
     tccataccca ctcccacatt ttgccaactc ccgtcccaga ttcaggctca gccaatccca      1920
     gcctcattct tggtctgggc tcaaccagaa gcaagctcta tccccagtcc aggcaccagt      1980
     atctgtgttt tgaggtaatg cttatagaac tttgggcttc aagctacacc tccaactcat      2040
     ctccagtttc acccctattc ccacccagtc aaaagttggg tctagacctt acttccactc      2100
     acacccctca gtaatgcctt ccggagagcc cgggtgatca gtgccctagc ctgcaagctg      2160
     cctgagctct gcccctatcc ccaccccgac tcctgagcca gccctcaggt ccccagtgag      2220
     tagtctgatg cccatctcca gtggccctct tatggtgcca ggccaggcct ctctcaagca      2280
     gcctcccact tctaggatct tgcacaagct ctgcaggacc ctgggcctca acctgactca      2340
     gttcacacag tatgatgaga acacgtggac ggaggtgcat aatgtgaagc tgcgaaacta      2400
     tgtggtggag aagatgccag aaaagctggg ctacaacctg aacaacaggg aaaggggcca      2460
     ttccccagag gacatctacc agatggcact caacaaggtg gccaccggct ttcctgcaga      2520
     gctcagccct gcccccaaga gtcttgtgtc tactactatc acgtctgctg atggctagcg      2580
     ggtgttttct ccatccctcc agctcaccca ctactgtagc ccctggcact cactcccagg      2640
     accctccagc aacactgcta ctctgtgtcc ccatctgctt gactcggaca gtgctgtcag      2700
     acatcaccct cttttcgtgt cccaaaagga tctttccatc cagatgatcc tgcctacaac      2760
     tccatgtacc tccccagtgc ctctcaggcc catgagccag accagctttc cctctcctta      2820
     gtccacctgg tgatccaggc ataccctcct ctgctcctgg aacccaacct tcctcatcca      2880
     tcacccctaa gtctgtatcc tcgacttcca ccttacccat gacaaggagg tctaggtaaa      2940
     gaggctggag gccatgtttg gaaggagctc aaagatcact aaatgccagg ctggagagcc      3000
     tgcatatagc aggggaggca gccctgctct ctatacttta gaactacaac tgccttctgc      3060
     aagaaagggt taacggaggc agctggtcct tgggggccag tagaggtggg actctagtgg      3120
     ttcctcctgg gggtgggggt ggggagctaa gggaagttgt gggtgagggg ggacactact      3180
     gaatagtctt tgctggtagt atcatcctct tggactgtga gaggccctca cctgcctatg      3240
     cccacaatgg tctagacaat gatctctact ggcttgccct cactggcctg cacaaaaaca      3300
     cacgctactg ctgactgggt ggacagacag ggaaacccag tatttggagg actcccgctt      3360
     cagagcaggt gtatgcatca tgagctaatg cctgggacct gaagtgaggt aaattgctgt      3420
     tcctgctgca acaagggtcc tctgattgtc cccacaggcc ttcaaagacc tcaaggcctt      3480
     gggctgcaag aaagccatga ataagttcaa caagcatacg cttctggtga gtgaggcaag      3540
     gtgatttccc tcttctgtca caagagatag ttgtgataca gggctcagca ggaaaggaag      3600
     gtctgattag tgcccctgcc cactgcacag gaatacctcc tcgaggaggg caacctgtcc      3660
     cggccggctg tgcagctcct gggagatgtg atgtccgagg agggcttctt ctacctcagc      3720
     tttgcagaag ccttacgtgc gcacgcctgc ctgagcgata gactccggtg agggcacaac      3780
     ggatggggca agccacaagg cggggcaacc tgggagggac agggccagag gggacagggc      3840
     cttaagagtt ggggtcagtg tgcccgccct tctttgcccc gccctgtagg tacagccgca      3900
     tcgtaggtgg ctgggacctg cttccgcgag ctctgctgag ctcactgtcc ggggcgctgc      3960
     tactgaacgc gcctgtggtg tcgatcactc aggggaggaa cgatgtgcgc gtgcacattg      4020
     ccacctcgct tcacagcgag aagacgctga cagccgacgt ggtgctgctg actgccagtg      4080
     gacccgcgct gcagcgcatt accttctcgc cgcccttgac tcgcaagagg caggaggcac      4140
     tgcgcgcgct tcactacgta gcagccagca aggtttttct gagtttccgt cggcccttct      4200
     ggcacgagga gcacatcgag ggcggccact ccaacactga ccgcccatcg cgcctcatat      4260
     tctatcccgc gcagggcgag ggctcactgc ttctggcctc ctacacgtgg tcggacgctg      4320
     cagccccctt cgctggactg agcaccgacc agaccctgcg tttggtgctc caggacgtgg      4380
     cggccctgca cgggcctgtg gtgttccggc tgtgggacgg caggggtgtg gtcaagcgct      4440
     gggcagagga cccgcatagc cagggaggct tcgtggtgca gccgccattg tacgggcgcg      4500
     aggctgagga ctatgactgg tcagccccct tcggccgcat ttacttcgcg ggcgagcaca      4560
     cagctctccc gcatggctgg gtagagaccg ctgtcaagtc cgggttgcgg gccgcggtga      4620
     gaatcaataa taactatggg tacggggagg tcgaccccca gatgatggag catgcatatg      4680
     cagaggccaa ctatctggac cagtatcctg aaggggagag gcccgaggag cagcaggcgc      4740
     gggaagaagt cagcccagat gaacaggagc cctctcacaa acacttgttg gtggaaacga      4800
     gccccgaggg gcagcaacac gcgtttgtgg aggccattcc cgagctgcag ggacacgtgt      4860
     tcgtggagac tgtcccccag gagaaggggc acgcccacca gaatatatat ccttcggagc      4920
     atgtacaggt gcatggggaa gtcatccctg agtggcatgg tcatggggga tctggcaccc      4980
     cgcaaatgca ccgagtgggg gaccactcct aatcgcaaag aggaagtgag cacccagctc      5040
     ctaagccagc cctcttcagg gcagacagac cacctacact aatagcccac aataaagtta      5100
     tttttgttaa accacaggct cacttccctc cacaatgcac tggtttccag aatataactg      5160
     ccctaggtgg ggcgacactt gagtgaatga acactacacc gtggtgaaga gatcagaagc      5220
     cattggatgc tggggtgctg acagatcctg actggaacaa aaacccagca accttgaggc      5280
     cagcatgggc tatgagcaag atgggaaaag caaagtgtcc tgatgccagc cagcgcagtc      5340
     aaccaagaac ggtttattgc ctcacaatgg cagcagctgg tgggcgggca ctcgggaatc      5400
     ccggacctct aggag                                                       5415
//


spacer
spacer