Dbfetch

ID   AY161042; SV 1; linear; mRNA; STD; MUS; 1362 BP.
XX
AC   AY161042;
XX
DT   04-DEC-2002 (Rel. 74, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus 1-acylglycerolphosphate acyltransferase-epsilon mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1362
RA   Lu B., Jiang Y.J., Chan M., Choy P.C.;
RT   "Identification and characterization of 1-acylglycerolphosphate
RT   acyltransferase-epsilon";
RL   Unpublished.
XX
RN   [2]
RP   1-1362
RA   Lu B., Jiang Y.J., Chan M., Choy P.C.;
RT   ;
RL   Submitted (08-OCT-2002) to the INSDC.
RL   Biochemistry and Medical Genetics, University of Manitoba, 770 Bannatyne
RL   Ave, Winnipeg, MB R3E 0W3, Canada
XX
DR   MD5; 839805e170e9b60ac87cc0a14d1aa9a3.
DR   Ensembl-Gn; ENSMUSG00000031467; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033386; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033316; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033386; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0033099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032421; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0033072; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033226; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0033174; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033319; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0033211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033915; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0032134; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032537; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000149565; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0088283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0088369; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0088300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0088318; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087882; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0088832; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0088412; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0087828; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0088027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0087864; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0088056; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087903; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0089122; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0087821; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086920; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1362
FT                   /organism="Mus musculus"
FT                   /strain="NMRI"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             259..1356
FT                   /codon_start=1
FT                   /product="1-acylglycerolphosphate acyltransferase-epsilon"
FT                   /EC_number="2.3.1.51"
FT                   /note="alcyltransferase"
FT                   /db_xref="GOA:Q9D1E8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR032098"
FT                   /db_xref="MGI:MGI:1196345"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E8"
FT                   /protein_id="AAN75571.1"
FT                   /translation="MLLSLVLHTYSMRYLLPSVLLLGSAPTYLLAWTLWRVLSALMPAR
FT                   LYQRVDDRLYCVYQNMVLFFFENYTGVQILLYGDWPKNKENVIYLANHQSTVDWIVADM
FT                   LAARQDALGHVRYVLKDKLKWLPMYGFYFAQHGGIYVKRSAKFNDKEMRSKLQSYVNAG
FT                   TPMYLVIFPEGTRYNATYTKLLSASQAFAAQRGLAVLKHVLTPRIKATHVAFDSMKSHL
FT                   DAIYDVTVVYEGNEKGSGKYSNPPSMTEFLCKQCPKLHIHFDRIDRNEVPEEQEHMKKW
FT                   LHERFEIKDRLLIEFYDSPDPERRNKFPGKSVHSRLSVKKTLPSVLILGSLTAVMLMTE
FT                   SGRKLYMGTWLYGTLLGCLWFVIKA"
FT   misc_feature    259..1353
FT                   /note="Region: phosphate acyltransferase"
FT   misc_feature    295..363
FT                   /note="transmembrane-region site"
FT   misc_feature    1291..1347
FT                   /note="transmembrane-region site"
XX
SQ   Sequence 1362 BP; 345 A; 328 C; 383 G; 306 T; 0 other;
     gcgcggagct aaagcgagca ccccgaggcg agtgcgcccg gcaagccgag gcgtgccctt        60
     tccaaggcgg cgagcagagg ccgtcactgt ccccgccggg tccctgggcc cccgcggccc       120
     atgctggggg cggagccagg gcggagggcg gcggctgcgg ccggccccgc gcagtgattg       180
     gcgggcggcc ggcggtggct gaggtcctgg tggccgcgcg ggcaacgcag gcggagtcgc       240
     ggctggcgag ccgagaggat gctgctgtcc ctggtgctcc acacgtactc tatgcgctac       300
     ctgctcccca gcgtcctgtt gctgggctcg gcgcccacct acctgctggc ctggacgctg       360
     tggcgggtgc tctccgcgct gatgcccgcc cgcctgtacc agcgcgtgga cgaccggctt       420
     tactgcgtct accagaacat ggtgctcttc ttcttcgaga actacaccgg ggtccagata       480
     ttgctatatg gagattggcc aaaaaataaa gaaaatgtaa tatatctagc gaatcatcaa       540
     agcacagttg actggattgt tgcggacatg ctggctgcca gacaggatgc cctaggacat       600
     gtgcgctacg tactgaaaga caagttaaaa tggcttccga tgtatgggtt ctactttgct       660
     cagcatggag gaatttatgt aaaacgaagt gccaaattta atgataaaga aatgagaagc       720
     aagctgcaga gctatgtgaa cgcaggaaca ccgatgtatc ttgtgatttt cccagaggga       780
     acaaggtata atgcaacata cacaaaactc ctttcagcca gtcaggcatt tgctgctcag       840
     cggggccttg cagtattaaa acacgtactg acaccaagaa taaaggccac tcacgttgct       900
     tttgattcta tgaagagtca tttagatgca atttatgatg tcacagtggt ttatgaaggg       960
     aatgagaaag gttcaggaaa atactcaaat ccaccatcca tgactgagtt tctctgcaaa      1020
     cagtgcccaa aacttcatat tcactttgat cgtatagaca gaaatgaagt tccagaggaa      1080
     caagaacaca tgaaaaagtg gcttcatgag cgctttgaga taaaagatag gttgctcata      1140
     gagttctatg attcaccaga tccagaaaga agaaacaaat ttcctgggaa aagtgttcat      1200
     tccagactaa gtgtgaagaa gactttacct tcagtgttga tcttggggag tttgactgct      1260
     gtcatgctga tgacggagtc cggaaggaaa ctgtacatgg gcacctggtt gtatggaacc      1320
     ctccttggct gcctgtggtt tgttattaaa gcataagcaa gt                         1362
//