Dbfetch

ID   AY161007; SV 1; linear; mRNA; STD; MUS; 2943 BP.
XX
AC   AY161007;
XX
DT   01-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus chloride channel (Clca5) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2943
RX   DOI; 10.1074/jbc.M408334200.
RX   PUBMED; 15292178.
RA   Beckley J.R., Pauli B.U., Elble R.C.;
RT   "Re-expression of detachment-inducible chloride channel mCLCA5 suppresses
RT   growth of metastatic breast cancer cells";
RL   J Biol Chem 279(40):41634-41641(2004).
XX
RN   [2]
RP   1-2943
RA   Elble R.C., Beckley J.R.;
RT   "Identification of the mouse ortholog of tumor suppressor hCLCA2";
RL   Unpublished.
XX
RN   [3]
RP   1-2943
RA   Elble R.C.;
RT   ;
RL   Submitted (08-OCT-2002) to the INSDC.
RL   Molecular Medicine, Cornell University, VMC c4-175, Ithaca, NY 14850, USA
XX
DR   MD5; 4a1a520ca85564bfc7d6366aace08d72.
DR   Ensembl-Gn; ENSMUSG00000036960; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027957; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0027916; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0027882; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027928; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027658; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0028371; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0027111; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0027633; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0027773; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0027740; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0027884; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027773; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0028430; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026834; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0027191; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000040465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198993; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0064150; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0064178; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0064121; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0064101; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0063790; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0064595; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0064106; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0063750; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0063864; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0063821; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0064006; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0063823; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0064815; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0063641; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0063048; mus_musculus_wsbeij.
DR   EuropePMC; PMC1383427; 15284223.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2943
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2943
FT                   /gene="Clca5"
FT   CDS             34..2862
FT                   /codon_start=1
FT                   /gene="Clca5"
FT                   /product="chloride channel"
FT                   /note="calcium-activated chloride channel; expressed in
FT                   mammary and other epithelia; similar to human CLCA2;
FT                   putative breast cancer tumor suppressor"
FT                   /db_xref="GOA:Q8BG22"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR004727"
FT                   /db_xref="InterPro:IPR013642"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:2139758"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BG22"
FT                   /protein_id="AAO18366.1"
FT                   /translation="MTHRDSTGPVIGLKLVTLLFTLSPELLFLGAGLKLKENGYDGLLV
FT                   AINPRVPEDLKLITNIKEMITEASFYLFNATKRRVFFRNVQILVPATWTDHNYSRVRQE
FT                   SYDKANVIVAEQSEEHGDDPYTLQHRGCGQEGRYIHFTPSFLLNDELAAGYGARGRVFV
FT                   HEWAHLRWGVFDEYNNDKPFYVNGRNEIQVTRCSSDITGVFVCEKGLCPHEDCIISKIF
FT                   REGCTFLYNSTQNATGSIMFMPSLPSVVEFCNESTHNQEAPNLQNQVCSLRSTWDVITA
FT                   SSDLNHSLPVHGVGLPAPPTFSLLQAGDRVVCLVIDVSRKMAEGDRLLRLQQAAELYLM
FT                   QVVEAHTFVGIVTFDSKGEIRASLQQIYSDDDRKLLVSYLPTAVSTDAETNICAGVKKG
FT                   FEVVEERNGRADGSVLILVTSGADEHIANCLLTSMNSGSTIHSMALGSSAARKVGELSR
FT                   LTGGLKFFIPDKFTSNGMTEAFVRISSGTGDIFQQSLQVESVCETVQPQHQLADTMTVD
FT                   SAVGNDTLFLVTWQTGGPPEIALLDPSGRKYNTGDFIINLAFRTASLKIPGTAKHGHWT
FT                   YTLNNTHHSPQALKVTVASRASSLAMSPATLEAFVERDSTYFPQPVIIYANVRKGLHPI
FT                   LNATVVATVEPEAGDPVVLQLLDGGAGADVIRNDGIYSRYFSSFAVSGSYSLTVHVRHS
FT                   PSTSTLALPVPGNHAMYVPGYITNDNIQMNAPKNLGHRPVKERWGFSRVSSGGSFSVLG
FT                   VPDGPHPDMFPPCKITDLEAMKVEDDVVLSWTAPGEDFDQGQTTSYEIRMSRSLWNIRD
FT                   DFDNAILVNSSELVPQHAGTRETFTFSPKLVTHELDHELAEDAQEPYIVYVALRAMDRS
FT                   SLRSAVSNIALVSMSLPPNSSPVVSRDDLILKGVLTTVGLIAILCLIMVVAHCIFNRKK
FT                   RPSRKENETKFL"
XX
SQ   Sequence 2943 BP; 801 A; 721 C; 720 G; 701 T; 0 other;
     tccccgtgaa taaaccagag gtttcactgc aagatgaccc acagggacag cacaggacct        60
     gtcatcgggc tgaaacttgt gacccttctg ttcaccctaa gtccagaact tctgttcctg       120
     ggagctggat tgaagctgaa agagaatggc tatgatggat tgcttgttgc catcaatccc       180
     cgggtacccg aggatctgaa gctgattaca aacattaagg aaatgataac cgaagcttcc       240
     ttttacctgt tcaatgcgac caagaggagg gtgtttttca gaaatgtaca gattttagta       300
     cctgccactt ggacggatca taattacagt agagtaagac aagaatccta tgacaaggca       360
     aatgtcatag tggctgagca gagtgaggaa cacggagatg atccctacac cctacagcac       420
     agagggtgcg ggcaagaggg gagatacatc cacttcaccc ccagcttcct actcaacgat       480
     gagttagccg caggctatgg tgcgcgaggc agagtgtttg tccacgagtg ggcccatctc       540
     cgctggggtg tgttcgatga atataacaac gacaaaccgt tctacgtgaa tggacggaat       600
     gagattcaag tcaccaggtg ttcatctgac attacaggcg tttttgtgtg tgaaaagggc       660
     ctctgccccc atgaagactg cattattagc aagattttta gggaaggatg cacattcctc       720
     tacaacagca cccagaatgc aactggatca ataatgttca tgccaagttt accttctgtg       780
     gttgaattct gtaacgaaag tacacacaac caagaagctc caaacctcca gaaccaagtg       840
     tgcagcctca gaagcacttg ggacgtgatc acagcctcct ccgacctgaa ccatagcctc       900
     cccgtgcatg gggttggact tccagcccct cccacgttct ccctcttgca ggctggtgac       960
     cgagtggtct gcttagtgat tgatgtgtcc aggaagatgg cagagggaga cagactgctc      1020
     cgacttcaac aagcagccga actgtacttg atgcaggttg tcgaagctca cactttcgtg      1080
     ggcattgtca cttttgatag caaaggagaa atccgagcct cgctgcagca aatttacagt      1140
     gacgatgacc ggaagctgct ggtttcatac ctgccgaccg ccgtgtccac tgacgcagaa      1200
     acgaacatct gtgcaggggt taagaaaggc tttgaggtgg ttgaggagcg gaatggaaga      1260
     gctgacggct ctgtcctgat attagtgacc agtggagcag atgaacacat tgccaactgc      1320
     ctgctcacct cgatgaacag tggatccacc attcactcca tggccctggg ttcctctgca      1380
     gccagaaaag tgggggaatt atcacgtctt acaggaggtc taaagttctt cattccagat      1440
     aaatttactt ctaatggaat gactgaagct ttcgttcgaa tctcttctgg aacaggagac      1500
     attttccagc aaagcttaca ggttgagagc gtgtgcgaaa ctgtgcaacc ccagcaccag      1560
     ctggcggata ctatgactgt ggatagcgcc gtgggcaatg acacactttt tctagtcacg      1620
     tggcagactg gtggcccccc tgagattgca ttattggatc ctagcggaag aaaatacaac      1680
     actggtgact ttatcatcaa cctggccttt cggacagcca gccttaagat tccagggaca      1740
     gctaagcatg ggcactggac ttacacgctg aacaacaccc accattctcc ccaagctctg      1800
     aaagtgacag tggcctctcg tgcctccagc ctggccatgt ccccagccac tctggaagcc      1860
     tttgtggaaa gagacagcac ctattttcct cagccagtga tcatttatgc gaatgtgagg      1920
     aaaggtctgc atcccattct caatgccacc gtggtggcga cagtggaacc agaggctgga      1980
     gatcccgttg tactgcaact tttggatggc ggagcaggtg cagatgttat aagaaatgat      2040
     gggatttact ccaggtattt ttcctccttt gctgtaagtg gtagctatag cctgacagtg      2100
     catgtccgtc actctcccag cacaagcaca ctagccctcc ctgtcccagg aaaccatgct      2160
     atgtatgtac caggttacat aacaaacgat aatattcaaa tgaatgctcc caaaaacttg      2220
     ggccacagac ctgtgaagga gaggtggggc ttcagtcgag tgagctcggg aggctccttc      2280
     tccgtgctgg gagtcccaga cggcccccac cctgacatgt ttccaccgtg caaaattact      2340
     gacctggaag ccatgaaagt ggaagacgac gtcgtcctct cttggacggc acctggggaa      2400
     gacttcgatc aggggcaaac tacaagctat gaaataagaa tgagcagaag cctatggaac      2460
     attcgggatg actttgacaa tgccatcttg gtgaattcgt cagagctagt tcctcagcat      2520
     gctggcacca gggagacatt tacattctca cccaagcttg tcacccatga acttgatcat      2580
     gaacttgctg aagatgcaca agaaccctac atagtgtatg tggccctgag agccatggat      2640
     agaagctccc tcaggtcagc tgtgtcaaac attgccctgg tatcaatgtc tcttcctcca      2700
     aactcttctc ctgtagtgag cagagatgat ctgatcctga aaggagtttt aacaacagta      2760
     ggtttgatag caatcctttg ccttattatg gttgtagcac actgtatttt taacaggaaa      2820
     aagagaccat caagaaaaga gaatgagaca aaatttctat gaacaagcag gcacagtatc      2880
     ttccttctta ggtaggatgg acatgacctt tacatccaca aaataaaatg tgaacaaaat      2940
     caa                                                                    2943
//