spacer

EBI Dbfetch

ID   AY159802; SV 1; linear; mRNA; STD; MUS; 1653 BP.
XX
AC   AY159802;
XX
DT   01-NOV-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus CDP-diacylglycerol synthase 2 (Cds2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1653
RA   Inglis S.L., Hunt D.M., Halford S.;
RT   "Isolation and characterization of murine Cds (CDP-diacylglycerol synthase)
RT   1 and 2";
RL   Unpublished.
XX
RN   [2]
RP   1-1653
RA   Inglis S.L., Hunt D.M., Halford S.;
RT   ;
RL   Submitted (07-OCT-2002) to the INSDC.
RL   Faculty of Medicine, Imperial College, Room 214 L-Block, Hammersmith
RL   Hospital Du Cane Road, London W12 0NN, UK
XX
DR   MD5; 2fd14bde37973c27bc7b9c373f734e8b.
DR   Ensembl-Gn; ENSMUSG00000058793; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103181; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1653
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..1653
FT                   /gene="Cds2"
FT   CDS             220..1554
FT                   /codon_start=1
FT                   /gene="Cds2"
FT                   /product="CDP-diacylglycerol synthase 2"
FT                   /db_xref="GOA:Q99L43"
FT                   /db_xref="InterPro:IPR000374"
FT                   /db_xref="InterPro:IPR016720"
FT                   /db_xref="MGI:MGI:1332236"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99L43"
FT                   /protein_id="AAO17790.1"
FT                   /translation="MTELRQRVVREDAPPEDKESESEAKLDGETASDSESRAETAPLPT
FT                   SVDDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKC
FT                   FHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSK
FT                   YHRFISFALYLTGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMI
FT                   WFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMS
FT                   GYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSAIGWKTVRMYPFQIHSIA
FT                   LSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASF
FT                   IRGPNPSKLIQQFLTLRPDQQLHIFNTLKSHLTDKGILTSALEDE"
XX
SQ   Sequence 1653 BP; 346 A; 447 C; 449 G; 411 T; 0 other;
     cggccgctgg ggaaacagcg gctccgctct ccgggcaagg gcggcggcag cggtgctggg        60
     cggggccggg ctcggggcta gtggcgctgc tgcaggggct gtgcgaggca cggtggggct       120
     gcgaggtgct cgggcccgcc gagagcccgt gctcactgag ccgacccccg cggccaccgt       180
     gctgctcact cggggtgacg tcgcgccggg gtccccagca tgaccgaact acggcagagg       240
     gttgtccgcg aggacgcacc tccggaggac aaggaatcag agtccgaagc aaagctagat       300
     ggagagacag cgtctgacag cgagagccga gcggaaacag ctcccctacc aacctccgta       360
     gatgacaccc cagaggtcct taacagggcc ctttccaacc tgtcctcaag gtggaagaac       420
     tggtgggtga gaggcatcct gactttggcc atgatcgcgt ttttcttcat tatcatttac       480
     ctgggaccaa tggttttgat gatgattgtt atgtgtgtcc agattaagtg tttccatgaa       540
     ataatcacta ttggctacaa tgtataccac tcctacgacc tgccctggtt caggaccctc       600
     agctggtact tcctgctgtg tgtgaactac ttcttctatg gggagacagt gacggactac       660
     ttcttcactc tggtccagag agaggagcct ttgcggatcc tcagtaaata ccaccggttc       720
     atctcctttg ccctgtatct gacaggattc tgcatgtttg tactgagtct agttaagaag       780
     cattatcggc tgcagttcta catgtttggc tggacccatg tgaccttgct tattgtcgta       840
     acgcagtcac accttgttat ccataacttg tttgaaggaa tgatatggtt tattgttccc       900
     atctcgtgcg tcatctgcaa tgacattatg gcctatatgt ttggcttttt ctttggtcgg       960
     accccactca ttaagctctc tccaaagaag acctgggaag gcttcattgg gggcttcttt      1020
     gccactgtgg tgtttggcct tttgctctcc tatgtgatgt ctgggtacag atgcttcgtg      1080
     tgtcccgtgg aatacaacaa tgacaccaac agcttcactg tggactgtga gccgtctgac      1140
     ctattccgcc tgcaggagta caacatccct ggggtgatcc agtcggccat tggctggaaa      1200
     acggtgagga tgtacccttt ccagatccac agcatcgccc tctccacctt cgcctcgctc      1260
     atcggccctt tcggagggtt cttcgccagt ggattcaaac gggcctttaa aatcaaagat      1320
     tttgccaata ccattcccgg tcatggaggc atcatggatc gctttgactg ccagtacctg      1380
     atggccacct ttgtcaatgt gtacatcgcc agctttatca ggggtccaaa cccaagcaaa      1440
     ctgatccagc agtttctgac gttgcggcca gatcagcagc ttcacatctt caacacgctc      1500
     aagtctcacc taactgacaa ggggattctg acatctgcct tggaagatga gtagagtcca      1560
     cctggggccc agagagctgg agcaggatgg agtgggggcc agtcgccaag gccgcccagc      1620
     tgctgtgact tagataatga aaagcttcaa ctc                                   1653
//


spacer
spacer