spacer

EBI Dbfetch

ID   AY157538; SV 1; linear; mRNA; STD; MUS; 2062 BP.
XX
AC   AY157538;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus strain NZW interleukin-4 induced gene-1 protein (Il4i1) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2062
RA   Chu C.C., Kim J.A., Hsueh K.;
RT   "Interleukin-four induced gene-1 polymorphisms correlate with Sle3
RT   autoimmune susceptibility";
RL   Unpublished.
XX
RN   [2]
RP   1-2062
RA   Chu C.C., Kim J.A., Hsueh K.;
RT   ;
RL   Submitted (01-OCT-2002) to the INSDC.
RL   Department of Medicine, Research Institute, North Shore University
RL   Hospital, NYU School of Medicine, 350 Community Drive, Manhasset, NY 11030,
RL   USA
XX
DR   MD5; 47c9d0fcb7697421556bfa7f0f5baaa1.
DR   Ensembl-Gn; ENSMUSG00000074141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033015; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2062
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="NZW"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   gene            1..2062
FT                   /gene="Il4i1"
FT                   /note="Fig1; interleukin-four induced gene-1"
FT   CDS             52..1944
FT                   /codon_start=1
FT                   /gene="Il4i1"
FT                   /product="interleukin-4 induced gene-1 protein"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAO17039.1"
FT                   /translation="MAGLALRLVLAVTLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQELSHKHLLVETSPEGQQHMFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   polyA_signal    2023..2028
FT                   /gene="Il4i1"
FT   polyA_site      2049
FT                   /gene="Il4i1"
XX
SQ   Sequence 2062 BP; 460 A; 579 C; 637 G; 386 T; 0 other;
     gccctgcagt cctgcccaag agagctgaag acagcagctg ccacttgagc catggctggg        60
     ctggccctgc gtcttgtcct ggcggtcacc ctccttggtc tggcaggctc tctggactgg       120
     aaggcagcct ccagcttgaa ccctattgag aagtgtatgg aggaccacga ttatgagcag       180
     ctactcaagg tggtgacctt gggcctcaat cggacttcga agccccagaa ggtggtagtg       240
     gttggtgcag gcgtggcagg gctggtagca gccaagatgc tcagtgatgc aggacacaag       300
     gtcaccatcc tggaggcaga taacaggatt gggggccgta tcttcacttt ccgggatgag       360
     aagacaggct ggatagggga gcttggggcc atgcgaatgc ccagctctca caggatcttg       420
     cacaagctct gcaggaccct gggcctcaac ctgactcagt tcacacagta tgatgagaac       480
     acgtggacgg aggtgcataa tgtgaagctg cgaaactatg tggtggagaa gatgccagaa       540
     aagctgggct acaacctgaa caacagggaa aggggccatt ccccagagga catctaccag       600
     atggcactca acaaggcctt caaagacctc aaggccttgg gctgcaagaa agccatgaat       660
     aagttcaaca agcatacgct tctggaatac ctcctcgagg agggcaacct gtcccggccg       720
     gctgtgcagc tcctgggaga tgtgatgtcc gaggagggct tcttctacct cagctttgca       780
     gaagccttac gtgcgcacgc ctgcctgagc gatcgactcc ggtacagccg catcgtaggt       840
     ggctgggacc tgcttccgcg agctctgctg agctcactgt ccggggcgct gctactgaac       900
     gcgcctgtgg tgtcgatcac tcaggggagg aacgatgtgc gcgtgcacat tgccacctcg       960
     cttcacagcg agaagacgct gacagccgac gtggtgctgc tgactgccag tggacccgcg      1020
     ctgcagcgca ttaccttctc gccgcccttg actcgcaaga ggcaggaggc actgcgcgcg      1080
     cttcactacg tagcagccag caaggttttt ctgagtttcc gtcggccctt ctggcacgag      1140
     gagcacatcg agggcggcca ctccaacact gaccgcccat cgcgcctcat attctatccc      1200
     gcgcggggcg agggctcact gcttctggcc tcctacacgt ggtcggacgc tgcagccccc      1260
     ttcgctggac tgagcaccga ccagaccctg cgtttggtgc tccaggacgt ggcggccctg      1320
     cacgggcctg tggtgttccg gctgtgggac ggcaggggtg tggtcaagcg ctgggcagag      1380
     gacccgcata gccagggagg cttcgtggtg cagccgccat tgtacgggcg cgaggctgag      1440
     gactatgact ggtcagcccc ctttggccgc atttactttg cgggcgagca cacagctctc      1500
     ccgcatggct gggtagagac cgctgtcaag tccgggttgc gggccgcggt gagaatcaat      1560
     aataactatg ggtacgggga ggtcgacccc cagatgatgg agcatgcata tgcagaggcc      1620
     aactatctgg accagtatcc tgaaggggag aggcccgagg agcagcaggc gcgggaagaa      1680
     gtcagcccag atgaacagga gctctctcac aaacacttgt tggtggaaac gagccccgag      1740
     gggcagcaac acatgtttgt ggaggccatt cccgagctgc agggacacgt gttcgtggag      1800
     actgtccccc aggagaaggg gcacgcccac cagaatatat atccttcgga gcatgtacag      1860
     gtgcatgggg aagtcatccc tgagtggcat ggtcatgggg gatctggcac cccgcaaatg      1920
     caccgagtgg gggaccactc ctaatcgcaa agaggaagtg agcacccagc tcctaagcca      1980
     gccctcttca gggcagacag accacctaca ctaatagccc acaataaagt tatttttgtt      2040
     aaaagccaca aaaaaaaaaa aa                                               2062
//


spacer
spacer