Dbfetch

ID   AY157537; SV 1; linear; genomic DNA; STD; MUS; 5408 BP.
XX
AC   AY157537;
XX
DT   04-OCT-2003 (Rel. 77, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Mus musculus strain NZW interleukin-4 induced gene-1 protein (Il4i1) gene,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-5408
RA   Chu C.C., Kim J.A., Hsueh K.;
RT   "Interleukin-four induced gene-1 polymorphisms correlate with Sle3
RT   autoimmune susceptibility";
RL   Unpublished.
XX
RN   [2]
RP   1-5408
RA   Chu C.C., Kim J.A., Hsueh K.;
RT   ;
RL   Submitted (01-OCT-2002) to the INSDC.
RL   Department of Medicine, Research Institute, North Shore University
RL   Hospital, NYU School of Medicine, 350 Community Drive, Manhasset, NY 11030,
RL   USA
XX
DR   MD5; e1fbd04e91a364458f04735d6749559b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5408
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /strain="NZW"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            592..5108
FT                   /gene="Il4i1"
FT                   /note="Fig1; interleukin-four induced gene-1"
FT   mRNA            join(592..621,809..842,936..1171,1681..1793,2294..2495,
FT                   3455..3523,3628..3764,3887..5108)
FT                   /gene="Il4i1"
FT                   /product="interleukin-4 induced gene-1 protein"
FT   5'UTR           join(592..621,809..829)
FT                   /gene="Il4i1"
FT   exon            592..621
FT                   /gene="Il4i1"
FT                   /number=1
FT   exon            809..842
FT                   /gene="Il4i1"
FT                   /number=2
FT   CDS             join(830..842,936..1171,1681..1793,2294..2495,3455..3523,
FT                   3628..3764,3887..5009)
FT                   /codon_start=1
FT                   /gene="Il4i1"
FT                   /product="interleukin-4 induced gene-1 protein"
FT                   /db_xref="GOA:O09046"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="MGI:MGI:109552"
FT                   /db_xref="PDB:2I8W"
FT                   /db_xref="UniProtKB/Swiss-Prot:O09046"
FT                   /protein_id="AAO17038.1"
FT                   /translation="MAGLALRLVLAVTLLGLAGSLDWKAASSLNPIEKCMEDHDYEQLL
FT                   KVVTLGLNRTSKPQKVVVVGAGVAGLVAAKMLSDAGHKVTILEADNRIGGRIFTFRDEK
FT                   TGWIGELGAMRMPSSHRILHKLCRTLGLNLTQFTQYDENTWTEVHNVKLRNYVVEKMPE
FT                   KLGYNLNNRERGHSPEDIYQMALNKAFKDLKALGCKKAMNKFNKHTLLEYLLEEGNLSR
FT                   PAVQLLGDVMSEEGFFYLSFAEALRAHACLSDRLRYSRIVGGWDLLPRALLSSLSGALL
FT                   LNAPVVSITQGRNDVRVHIATSLHSEKTLTADVVLLTASGPALQRITFSPPLTRKRQEA
FT                   LRALHYVAASKVFLSFRRPFWHEEHIEGGHSNTDRPSRLIFYPARGEGSLLLASYTWSD
FT                   AAAPFAGLSTDQTLRLVLQDVAALHGPVVFRLWDGRGVVKRWAEDPHSQGGFVVQPPLY
FT                   GREAEDYDWSAPFGRIYFAGEHTALPHGWVETAVKSGLRAAVRINNNYGYGEVDPQMME
FT                   HAYAEANYLDQYPEGERPEEQQAREEVSPDEQELSHKHLLVETSPEGQQHMFVEAIPEL
FT                   QGHVFVETVPQEKGHAHQNIYPSEHVQVHGEVIPEWHGHGGSGTPQMHRVGDHS"
FT   exon            936..1171
FT                   /gene="Il4i1"
FT                   /number=3
FT   exon            1681..1793
FT                   /gene="Il4i1"
FT                   /number=4
FT   exon            2294..2495
FT                   /gene="Il4i1"
FT                   /number=5
FT   exon            3455..3523
FT                   /gene="Il4i1"
FT                   /number=6
FT   exon            3628..3764
FT                   /gene="Il4i1"
FT                   /number=7
FT   exon            3887..5108
FT                   /gene="Il4i1"
FT                   /number=8
FT   3'UTR           5010..5108
FT                   /gene="Il4i1"
FT   regulatory      5088..5093
FT                   /gene="Il4i1"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 5408 BP; 1207 A; 1539 C; 1523 G; 1139 T; 0 other;
     cagttttggc agaggcttct agggtcattt ctctgaggtg tcagtctaga gtctgctgcc        60
     cggcagtact taagacaaag caggaaggac aaaggacaag tggccactta gccatcacca       120
     accagtcctg cccatgtttc tgcagctgca gcaaacaggt tctggacctg gccaggtgct       180
     atatgcaggc cctgacctgg ctccattcct gccattgtgc tggaccatgt gacatgagca       240
     ggcctatatg ggcttcaaat gtgaaaggcc cagacttgtg tgtgcccatt tcatacagac       300
     attcctggag agatggggag gggatgggca gacccaagac aaaagtccaa gaagcctaga       360
     gcacagggtc caccatcaac actgccacct gggtgggtag tccccacccc cagcttcccc       420
     aaagctattt gaagcaggaa gaagaaaaat agactgagtt acttcctcct gtgatattta       480
     ttcccatcac ctcccccagc atctgaccct agctcaggaa agcactttta attccccagg       540
     gaggtgagtg ggcggggctg gctactttaa ggggagagtc gcagaggctc tgccctgcag       600
     tcctgcccaa gagagctgaa ggtagagcta catggagggt ggtggcaatg actggaaccc       660
     agaacccaag gctggaaagc aggaggggag ggagccaggc cataatggtc aagattaggt       720
     ctggggaaat acatgcccag agaggaagga gggagacagg ctggggatcc ctggccccac       780
     cacattgacc ccctacttct tcactcagac agcagctgcc acttgagcca tggctgggct       840
     gggtaagtga gcagccaaga ggaggaggga gtgctggggt tacggctgac tcctgcactt       900
     ctggtgccta tgtgctgacc ctgtcctttt gccagccctg cgtcttgtcc tggcggtcac       960
     cctccttggt ctggcaggct ctctggactg gaaggcagcc tccagcttga accctattga      1020
     gaagtgtatg gaggaccacg attatgagca gctactcaag gtggtgacct tgggcctcaa      1080
     tcggacttcg aagccccaga aggtggtagt ggttggtgca ggcgtggcag ggctggtagc      1140
     agccaagatg ctcagtgatg caggacacaa ggtgagaagt gctgcctgta gtcctcaggg      1200
     agcctttcct gctgctggtg gggagtcctg ggtagtgtga cggagagaag ctaccctttc      1260
     ctagagcccc catttcattg acccactgca ctccacttac ccgtcctgga gggaaggcct      1320
     acttcctctt cttaatgtaa ttgtcaagag ttgagatggg gatttggagg taaggggcct      1380
     gagaaatcct caagggagag tatccctcac ctaaccctag gaatgagatt gggccagccc      1440
     caactcttct gtacaaacta ggaaatcccc ctcttcttgc cttaagctgg gaagtccctc      1500
     tacagtccat ctgctagtcc tcctgctaca gtcttgagac ctttctttcc gagcagcccc      1560
     tcctacccag aagaaaggcc cttgtattct aggtgtcctt tactattggg ggcaagacag      1620
     gcaggggcta gtgggaatgt agtgagggag ctgaggtccc tgttggccgc ttttctttag      1680
     gtcaccatcc tggaggcaga taacaggatt gggggccgta tcttcacttt ccgggatgag      1740
     aagacaggct ggatagggga gcttggggcc atgcgaatgc ccagctctca caggtgaggt      1800
     cccacctacc caggcagcag agccccacct ctgcaccaag gtttagctag agcccagttc      1860
     catacccact cccacattct gccaactccc gtcccagatt caggctcagc caatcccagc      1920
     ctcattcttg gtctgggctc aaccagaagc aagctctatc cccagtccag gcaccagtat      1980
     ctgtgttttg aggtgctgct tatagaactt tgggcttcaa gctacacctc caactcatct      2040
     ccagtttcac ccctattccc acccagtcaa aagttgggtc tagaccttac ttccactcac      2100
     acccgtcagt actgccttcc ggagagcccg ggtgatcagt gccctagcct gcaaactgcc      2160
     tgagctctgc ccctatcccc accccgactc ctgagccagc cctcaggtcc ccagtgagta      2220
     gtctgatgcc catctccagt ggccctctta tggtgccagg ccaggcctct ctcaagcagc      2280
     ctcccacttc taggatcttg cacaagctct gcaggaccct gggcctcaac ctgactcagt      2340
     tcacacagta tgatgagaac acgtggacgg aggtgcataa tgtgaagctg cgaaactatg      2400
     tggtggagaa gatgccagaa aagctgggct acaacctgaa caacagggaa aggggccatt      2460
     ccccagagga catctaccag atggcactca acaaggtggc caccggcttt cctgcagagc      2520
     tcagccctgc ccccaagagt cttgtgtcta ctactatcac gtctgctgat ggctagcggg      2580
     tgttttctcc atccctccag ctcacccact actgtagccc ctggcactca atcccaggac      2640
     cctccagcaa cactgctact ctgtgtcccc atctgcttga ctcggacagt gctgtcagac      2700
     atcaccctct tttcgtgtcc caaaaggatc tttccatcca gatgaccctg cctacaactc      2760
     catgtacctc cccagtgcct ctcaggccca tgagccagac cagctttccc tctccttagt      2820
     ccacctggtg atccaggcat accctcctct gctcctggaa cccaaccttc ctcatccatc      2880
     acccctaagt ctgtatcctc gacttccacc ttacccatga caaggaggtc taggtaaaga      2940
     ggctggaggc catgtttgga aggagctcaa agatcactaa atgccaggct ggagagcctg      3000
     aatatagcag gggaggcagc cctgctctct atactttaga actacaactg ccttctgcaa      3060
     gaaagggtaa cggaggcagc tggtccttgg gggccagtag aggtgggact ctagtggttc      3120
     ctcctggggg tgggggtggg gagctaaggg aagttgtggg tgagggggga cactactgaa      3180
     tagtctttgc tggtagtatc atcctcttgg actgtgagag gccctcacct gcctatgccc      3240
     acaatggtct agacaatgat ctctactggc tcgccctcac tggcctgcac aaaaacacac      3300
     gctactgctg actgggtgga cagacaggga aacccagtat ttggaggact cccgcttcag      3360
     agcaggtgta tgcatcatga gctaatgcct gggacctgaa gtgaggtaaa ttgctgttcc      3420
     tgctgcaaca agggtcctct gattgtcccc acaggccttc aaagacctca aggccttggg      3480
     ctgcaagaaa gccatgaata agttcaacaa gcatacgctt ctggtgagtg aggcaaggtg      3540
     atttccctct tctgtcacaa gagatagttg tgatacaggg ctcatcagga aaggaaggtc      3600
     tgattagtgc ccctgcccac tgcacaggaa tacctcctcg aggagggcaa cctgtcccgg      3660
     ccggctgtgc agctcctggg agatgtgatg tccgaggagg gcttcttcta cctcagcttt      3720
     gcagaagcct tacgtgcgca cgcctgcctg agcgatcgac tccggtgagg gcacaacgga      3780
     tggggcaagc cacaaggcgg ggcatcctgg gagggacagg gccagagggg acagggcctt      3840
     aagagttggg gtcagtgtgc ccgcccttct ttgccccgcc ctgtaggtac agccgcatcg      3900
     taggtggctg ggacctgctt ccgcgagctc tgctgagctc actgtccggg gcgctgctac      3960
     tgaacgcgcc tgtggtgtcg atcactcagg ggaggaacga tgtgcgcgtg cacattgcca      4020
     cctcgcttca cagcgagaag acgctgacag ccgacgtggt gctgctgact gccagtggac      4080
     ccgcgctgca gcgcattacc ttctcgccgc ccttgactcg caagaggcag gaggcactgc      4140
     gcgcgcttca ctacgtagca gccagcaagg tttttctgag tttccgtcgg cccttctggc      4200
     acgaggagca catcgagggc ggccactcca acactgaccg cccatcgcgc ctcatattct      4260
     atcccgcgcg gggcgagggc tcactgcttc tggcctccta cacgtggtcg gacgctgcag      4320
     cccccttcgc tggactgagc accgaccaga ccctgcgttt ggtgctccag gacgtggcgg      4380
     ccctgcacgg gcctgtggtg ttccggctgt gggacggcag gggtgtggtc aagcgctggg      4440
     cagaggaccc gcatagccag ggaggcttcg tggtgcagcc gccattgtac gggcgcgagg      4500
     ctgaggacta tgactggtca gccccctttg gccgcattta ctttgcgggc gagcacacag      4560
     ctctcccgca tggctgggta gagaccgctg tcaagtccgg gttgcgggcc gcggtgagaa      4620
     tcaataataa ctatgggtac ggggaggtcg acccccagat gatggagcat gcatatgcag      4680
     aggccaacta tctggaccag tatcctgaag gggagaggcc cgaggagcag caggcgcggg      4740
     aagaagtcag cccagatgaa caggagctct ctcacaaaca cttgttggtg gaaacgagcc      4800
     ccgaggggca gcaacacatg tttgtggagg ccattcccga gctgcaggga cacgtgttcg      4860
     tggagactgt cccccaggag aaggggcacg cccaccagaa tatatatcct tcggagcatg      4920
     tacaggtgca tggggaagtc atccctgagt ggcatggtca tgggggatct ggcaccccgc      4980
     aaatgcaccg agtgggggac cactcctaat cgcaaagagg aagtgagcac ccagctccta      5040
     agccagccct cttcagggca gacagaccac ctacactaat agcccacaat aaagttattt      5100
     ttgttaaacc acaggctcac ttccctccac aatgcactgg tttccagaat ataactgccc      5160
     tgggtggggc gacacttgag tgaatgaaca ctacactgtg gtgaagagat cagaagccat      5220
     tggatgctgg ggtgctgaca gatcctgact ggaacaaaaa cccagcaacc ttgaggccag      5280
     catgggctat gagcaagatg ggaaaagcaa agtgtcctga tgccagcgca gtcaaccaag      5340
     aaaggtttat tgcctcacaa tggcagcagc tggtgggcgg gcactcagga atcccggacc      5400
     tctaggag                                                               5408
//