Dbfetch

ID   AY148473; SV 1; linear; mRNA; STD; HUM; 1297 BP.
XX
AC   AY148473;
XX
DT   08-OCT-2003 (Rel. 77, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens soluble tumor necrosis factor receptor superfamily member 1B
DE   mRNA, complete cds; alternatively spliced.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1297
RX   DOI; 10.1093/intimm/dxh014.
RX   PUBMED; 14688072.
RA   Lainez B., Fernandez-Real J.M., Romero X., Esplugues E., Canete J.D.,
RA   Ricart W., Engel P.;
RT   "Identification and characterization of a novel spliced variant that
RT   encodes human soluble tumor necrosis factor receptor 2";
RL   Int. Immunol. 16(1):169-177(2004).
XX
RN   [2]
RP   1-1297
RA   Lainez B., Engel P.;
RT   ;
RL   Submitted (05-SEP-2002) to the INSDC.
RL   Immunology Unit Department Cellular Biology and Pathology, Medical School
RL   University of Barcelona, Casanova 143, Barcelona, Barcelona 08036, Spain
XX
DR   MD5; adeb6feb47b179eb5b3596ee0cf705df.
DR   Ensembl-Gn; ENSG00000028137; homo_sapiens.
DR   Ensembl-Tr; ENST00000376259; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1297
FT                   /organism="Homo sapiens"
FT                   /chromosome="1"
FT                   /map="1p36"
FT                   /mol_type="mRNA"
FT                   /cell_type="peripheral mononuclear cells"
FT                   /db_xref="taxon:9606"
FT   CDS             7..813
FT                   /codon_start=1
FT                   /product="soluble tumor necrosis factor receptor
FT                   superfamily member 1B"
FT                   /note="tumor necrosis factor receptor 2; alternatively
FT                   spliced"
FT                   /db_xref="GOA:P20333"
FT                   /db_xref="H-InvDB:HIT000250819.12"
FT                   /db_xref="HGNC:HGNC:11917"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR020411"
FT                   /db_xref="InterPro:IPR033996"
FT                   /db_xref="PDB:1CA9"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20333"
FT                   /protein_id="AAN72434.1"
FT                   /translation="MAPVAVWAALAVGLELWAAAHALPAQVAFTPYAPEPGSTCRLREY
FT                   YDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGPRCSPDQ
FT                   VETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKP
FT                   CAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVST
FT                   RSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVASLACR"
XX
SQ   Sequence 1297 BP; 258 A; 449 C; 385 G; 205 T; 0 other;
     gcacccatgg cgcccgtcgc cgtctgggcc gcgctggccg tcggactgga gctctgggct        60
     gcggcgcacg ccttgcccgc ccaggtggca tttacaccct acgccccgga gcccgggagc       120
     acatgccggc tcagagaata ctatgaccag acagctcaga tgtgctgcag caaatgctcg       180
     ccgggccaac atgcaaaagt cttctgtacc aagacctcgg acaccgtgtg tgactcctgt       240
     gaggacagca catacaccca gctctggaac tgggttcccg agtgcttgag ctgtggcccc       300
     cgctgtagcc ctgaccaggt ggaaactcaa gcctgcactc gggaacagaa ccgcatctgc       360
     acctgcaggc ccggctggta ctgcgcgctg agcaagcagg aggggtgccg gctgtgcgcg       420
     ccgctgcgca agtgccgccc gggcttcggc gtggccagac caggaactga aacatcagac       480
     gtggtgtgca agccctgtgc cccggggacg ttctccaaca cgacttcatc cacggatatt       540
     tgcaggcccc accagatctg taacgtggtg gccatccctg ggaatgcaag catggatgca       600
     gtctgcacgt ccacgtcccc cacccggagt atggccccag gggcagtaca cttaccccag       660
     ccagtgtcca cacgatccca acacacgcag ccaactccag aacccagcac tgctccaagc       720
     acctccttcc tgctcccaat gggccccagc cccccagctg aagggagcac tggcgacttc       780
     gctcttccag ttgcctcact tgcctgccga taaggcccgg ggtacacagg gccccgagca       840
     gcagcacctg ctgatcacag cgccgagctc cagcagcagc tccccggaga gctcggccag       900
     tgcgttggac agaagggcgc ccactcggaa ccagccacag gcaccaggcg tggaggccag       960
     tggggccggg gaggcccggg ccagcaccgg gagctcagat tcttcccctg gtggccttgg      1020
     gacccaggtc aatgtcacct gcatcgtgaa cgtctgtagc agctctgacc acagctcaca      1080
     gtgctcctcc caagccagct ccacaatggg agacacagat tccagcccct cggagtcccc      1140
     gaaggacgag caggtcccct tctccaaggg ggaatgtgcc tttcggtcac agctggagac      1200
     gccagagacc ctgctgggga gcaccgaaga gaagcccctg ccccttggag tgcctgatgc      1260
     tgggatgaag cccagttaac caggccggtg tgggctg                               1297
//