spacer

EBI Dbfetch

ID   AY135643; SV 1; linear; mRNA; STD; MUS; 2236 BP.
XX
AC   AY135643;
XX
DT   23-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus WAVE2 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2236
RA   Sossey-Alaoui K., Cowell J.K.;
RT   "Genomic organization and expression profiles of the human WAVE genes and
RT   their mouse orthologs";
RL   Unpublished.
XX
RN   [2]
RP   1-2236
RA   Sossey-Alaoui K., Cowell J.K.;
RT   ;
RL   Submitted (24-JUL-2002) to the INSDC.
RL   Cancer Genetics, Roswell Park Cancer Institute, Elm & Carlton Sts.,
RL   Buffalo, NY 14263, USA
XX
DR   MD5; 0c293271fe5b1277f5a58cee9699a63c.
DR   Ensembl-Gn; ENSMUSG00000028868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105912; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2236
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             113..1606
FT                   /codon_start=1
FT                   /product="WAVE2"
FT                   /db_xref="GOA:Q8BH43"
FT                   /db_xref="InterPro:IPR003124"
FT                   /db_xref="InterPro:IPR028288"
FT                   /db_xref="MGI:MGI:1098641"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BH43"
FT                   /protein_id="AAN10152.1"
FT                   /translation="MPLVTRNIEPRHLCRQTLPSDTSELECRTNITLANVIRQLGSLSK
FT                   YAEDIFGEICTQASAFASRVNSLAERVDRVQVKVTQLDPKEEEVSLQGINTRKAFRSST
FT                   TQDQKLFDRNSLPVPVLETYNSCDAPPPLNNLSPYRDDGKEALKFYTNPSYFFDLWKEK
FT                   MLQDTKDIMKEKRKHRKEKKDNPNRGNVNPRKIKTRKEEWEKMKMGQEFVESKERLGPS
FT                   GYSSTLVYQNGSIGSVENVDAASYPPPPQSDSASSPSPSFSEDNLPPPPAEFSYPADNQ
FT                   RGSVLAGPKRTSMVSPSHPPPAPPLSSPPGPKPGFAPPPAPPPPPPMSVPPPLPSMGFG
FT                   SPGTPPPPSPPSFPPHPDFAAPPPPPPPPAADYPMPPPPLSQPSGGAPPPPPPPPPPGP
FT                   PPLPFSGADGQPAAPPPPPPSEATKPKSSLPAVSDARSDLLSAIRQGFQLRRVEEQREQ
FT                   EKRDVVGNDVATILSRRIAVEYSDSEDDSSEFDEDDWSD"
XX
SQ   Sequence 2236 BP; 520 A; 693 C; 511 G; 512 T; 0 other;
     ggagactcac atagccctgt gtgcctggga tctgtggttg agtactgttt tcctgctctt        60
     tcccttttag gtttttttca tcattgagaa cctcgcctga agcaggtcca ctatgccgtt       120
     agtaaccagg aacatcgagc caaggcacct gtgccgtcag acgttgccta gcgatacaag       180
     cgagctggaa tgcaggacca acatcaccct ggcaaatgtc atccgacagc tgggcagcct       240
     gagtaagtat gcagaggaca ttttcggaga gatttgtact caggcaagtg cctttgcctc       300
     ccgagtaaac tcccttgctg agcgggttga ccgagtacaa gttaaagtca ctcagctgga       360
     tcccaaggaa gaagaagtgt cactacaagg aatcaatact cggaaggcct tcagaagttc       420
     taccacccaa gaccagaagc tctttgacag gaactctctc ccggtgcccg tcttagagac       480
     ctataacagc tgtgacgctc ctccccctct taacaatctc agtccttaca gggacgatgg       540
     aaaagaggca ctcaaattct acaccaaccc ctcatacttc tttgatcttt ggaaggagaa       600
     gatgctgcag gacaccaagg atatcatgaa agagaagaga aagcatagga aagaaaagaa       660
     agataatcca aatagaggga atgtgaaccc acgtaaaatc aagacacgca aggaagagtg       720
     ggagaagatg aaaatgggac aagaatttgt agagtccaag gagaggctgg ggccttctgg       780
     gtattcgtcc accttggtgt accagaatgg cagcattggc tctgttgaaa atgtggatgc       840
     ggccagctac ccgccaccac cacagtcgga ctctgcctcc tcaccttccc cttcattctc       900
     tgaagacaac ttgcctcccc cgccagcaga attcagctac cctgcagaca accaaagagg       960
     atctgtcttg gctggaccca aaagaaccag catggtcagc ccaagccatc cacccccagc      1020
     tcctcctctg agctctccgc caggtcccaa gcctggcttc gctcctccac ctgcccctcc      1080
     acctccacct cccatgagtg tgccacctcc actaccatcg atgggattcg ggtctcctgg      1140
     gacccctcca cccccatcac ctccatcttt ccctcctcac cctgattttg ctgctcctcc      1200
     accacctccc ccaccaccag cagctgacta cccaatgcca ccacctcctt tgtcccaacc      1260
     gtctggaggt gctcctccgc ctcctcctcc ccctccccct ccagggcccc cgcctctccc      1320
     cttcagcggt gctgatggcc agcctgctgc accaccacca ccaccacctt ctgaggccac      1380
     caagcccaag tcttcattgc ctgctgtgag tgacgcgcgc agtgacctgc tttctgccat      1440
     ccgccaaggc tttcagctgc gaagggttga agagcaacgg gagcaagaga agcgtgatgt      1500
     ggtgggcaat gatgtggcca ccatcctgtc ccgtcggatc gctgttgagt acagcgactc      1560
     ggaagatgat tcttctgaat ttgatgaaga cgactggtcg gattaactcc gcctgctgcc      1620
     cacattcctc tttctagtcc tcccacctgc cttcctccat acaaactaac agtctcatgg      1680
     ggggaagaaa gcaagggaca aagaactgca aggggccaaa gccaaagatc tatccgagtg      1740
     cttccttcaa atgaccatat gcttcttcct cgtgtctgcc tgcgggctcc tgagggtcca      1800
     cagctgagct gatccatctt tccctcaagt gaccgtatct agtgacagga agggagaacc      1860
     ctacagtaga tccctctgct tgggtttcaa ctggagatag tgccttcccc tgataaccat      1920
     tttaacccat ggccttcctc aaaacccttt catttagcta cttcaaataa tgttatccac      1980
     ctcctgtctc acagcagtgg gtacagcctg tgtgggcgca ggtggtccct tttctgtgcc      2040
     ctgacaagta gactggcaca cccctgcccc acactcagcc ttctgcagca ggtaggcttg      2100
     cttctgttag ctctgcctgg atgcctttgt tccagaaggc atcaagcctc taaagactgt      2160
     ctcacaagtg atgcccttct ggagactgag ggtgtggcct tcctcccatg ctctctctgg      2220
     gtgagtgtgg ggtctg                                                      2236
//


spacer
spacer