spacer

EBI Dbfetch

ID   AY099898; SV 1; linear; mRNA; STD; MUS; 421 BP.
XX
AC   AY099898;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin-related 1 isoform F (Mtmr1) mRNA, partial cds;
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-421
RX   DOI; 10.1093/hmg/11.19.2297.
RX   PUBMED; 12217958.
RA   Buj-Bello A., Furling D., Tronchere H., Laporte J., Lerouge T.,
RA   Butler-Browne G.S., Mandel J.L.;
RT   "Muscle-specific alternative splicing of myotubularin-related 1 gene is
RT   impaired in DM1 muscle cells";
RL   Hum. Mol. Genet. 11(19):2297-2307(2002).
XX
RN   [2]
RP   1-421
RA   Buj-Bello A., Mandel J.-L.;
RT   ;
RL   Submitted (25-APR-2002) to the INSDC.
RL   Human Genetics, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France
XX
DR   MD5; 68360713b3ee18f123357009b2baff81.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000156756; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..421
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /map="Xq28"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>421
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin-related 1 isoform F"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q8CIU3"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CIU3"
FT                   /protein_id="AAM21908.1"
FT                   /translation="HVEWCKQLIAATISSQISGSVTSENVSRDYKVFRRPDTRELEEEH
FT                   NGYPSEAEADQALRDGNKLAQMEEAPLFPGESIKAIVKDVIYICPFMGAVSGTLTVTDF
FT                   KMYFKNVERDPHFVLDVPLGVISRVEKIGAQSHGDN"
FT   exon            94..117
FT                   /gene="Mtmr1"
FT                   /number=2.1
FT                   /note="alternatively spliced"
FT   exon            118..168
FT                   /gene="Mtmr1"
FT                   /number=2.3
FT                   /note="alternatively spliced"
XX
SQ   Sequence 421 BP; 130 A; 75 C; 109 G; 107 T; 0 other;
     catgttgaat ggtgtaaaca gcttatagct gctacaattt ctagtcagat ttcaggttca        60
     gtgacatcag aaaatgtgtc aagagattac aaggttttca ggaggcctga taccagggag       120
     ctagaggaag aacacaatgg ctacccttct gaagctgaag ctgatcaggc tctaagggat       180
     ggaaataaac tggcacagat ggaagaagct ccacttttcc caggagaatc aattaaggcc       240
     attgtgaaag acgtcattta tatctgtcca tttatgggag cagtgagtgg gaccctgaca       300
     gtgacggact ttaaaatgta cttcaaaaat gtagaaaggg acccacattt cgtccttgat       360
     gttcctcttg gagtgatcag cagagtggag aagattggtg cacagagcca tggggataat       420
     t                                                                       421
//


spacer
spacer