spacer

EBI Dbfetch

ID   AY099897; SV 1; linear; mRNA; STD; MUS; 397 BP.
XX
AC   AY099897;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin-related 1 isoform E (Mtmr1) mRNA, partial cds;
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-397
RX   DOI; 10.1093/hmg/11.19.2297.
RX   PUBMED; 12217958.
RA   Buj-Bello A., Furling D., Tronchere H., Laporte J., Lerouge T.,
RA   Butler-Browne G.S., Mandel J.L.;
RT   "Muscle-specific alternative splicing of myotubularin-related 1 gene is
RT   impaired in DM1 muscle cells";
RL   Hum. Mol. Genet. 11(19):2297-2307(2002).
XX
RN   [2]
RP   1-397
RA   Buj-Bello A., Mandel J.-L.;
RT   ;
RL   Submitted (25-APR-2002) to the INSDC.
RL   Human Genetics, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France
XX
DR   MD5; 1f901e99c46928b437205fc469694de2.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132837; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..397
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /map="Xq28"
FT                   /strain="CD-1"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>397
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin-related 1 isoform E"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q8CIU4"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CIU4"
FT                   /protein_id="AAM21907.1"
FT                   /translation="HVEWCKQLIAATISSQISGSVTSENVSRDYKELEEEHNGYPSEAE
FT                   ADQALRDGNKLAQMEEAPLFPGESIKAIVKDVIYICPFMGAVSGTLTVTDFKMYFKNVE
FT                   RDPHFVLDVPLGVISRVEKIGAQSHGDN"
FT   exon            94..144
FT                   /gene="Mtmr1"
FT                   /number=2.3
FT                   /note="alternatively spliced"
XX
SQ   Sequence 397 BP; 125 A; 70 C; 101 G; 101 T; 0 other;
     catgttgaat ggtgtaaaca gcttatagct gctacaattt ctagtcagat ttcaggttca        60
     gtgacatcag aaaatgtgtc aagagattac aaggagctag aggaagaaca caatggctac       120
     ccttctgaag ctgaagctga tcaggctcta agggatggaa ataaactggc acagatggaa       180
     gaagctccac ttttcccagg agaatcaatt aaggccattg tgaaagacgt catttatatc       240
     tgtccattta tgggagcagt gagtgggacc ctgacagtga cggactttaa aatgtacttc       300
     aaaaatgtag aaagggaccc acatttcgtc cttgatgttc ctcttggagt gatcagcaga       360
     gtggagaaga ttggtgcaca gagccatggg gataatt                                397
//


spacer
spacer