spacer

EBI Dbfetch

ID   AY099896; SV 1; linear; mRNA; STD; MUS; 448 BP.
XX
AC   AY099896;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin-related 1 isoform D (Mtmr1) mRNA, partial cds;
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-448
RX   DOI; 10.1093/hmg/11.19.2297.
RX   PUBMED; 12217958.
RA   Buj-Bello A., Furling D., Tronchere H., Laporte J., Lerouge T.,
RA   Butler-Browne G.S., Mandel J.L.;
RT   "Muscle-specific alternative splicing of myotubularin-related 1 gene is
RT   impaired in DM1 muscle cells";
RL   Hum. Mol. Genet. 11(19):2297-2307(2002).
XX
RN   [2]
RP   1-448
RA   Buj-Bello A., Mandel J.-L.;
RT   ;
RL   Submitted (25-APR-2002) to the INSDC.
RL   Human Genetics, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France
XX
DR   MD5; a1f1a40374daf40be939cbc4d33405ef.
DR   Ensembl-Gn; ENSMUSG00000015214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130909; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..448
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /map="Xq28"
FT                   /mol_type="mRNA"
FT                   /cell_line="C2C12"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>448
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin-related 1 isoform D"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q8CIU5"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CIU5"
FT                   /protein_id="AAM21906.1"
FT                   /translation="HVEWCKQLIAATISSQISGSVTSENVSRDYKVFRRPDTRNIHKAR
FT                   QRLELEEEHNGYPSEAEADQALRDGNKLAQMEEAPLFPGESIKAIVKDVIYICPFMGAV
FT                   SGTLTVTDFKMYFKNVERDPHFVLDVPLGVISRVEKIGAQSHGDN"
FT   exon            94..117
FT                   /gene="Mtmr1"
FT                   /number=2.1
FT                   /note="alternatively spliced"
FT   exon            118..144
FT                   /gene="Mtmr1"
FT                   /number=2.2
FT                   /note="alternatively spliced"
FT   exon            145..195
FT                   /gene="Mtmr1"
FT                   /number=2.3
FT                   /note="alternatively spliced"
XX
SQ   Sequence 448 BP; 144 A; 78 C; 113 G; 113 T; 0 other;
     catgttgaat ggtgtaaaca gcttatagct gctacaattt ctagtcagat ttcaggttca        60
     gtgacatcag aaaatgtgtc aagagattac aaggttttca ggaggcctga taccaggaat       120
     attcataaag caagacaaag attggagcta gaggaagaac acaatggcta cccttctgaa       180
     gctgaagctg atcaggctct aagggatgga aataaactgg cacagatgga agaagctcca       240
     cttttcccag gagaatcaat taaggccatt gtgaaagacg tcatttatat ctgtccattt       300
     atgggagcag tgagtgggac cctgacagtg acggacttta aaatgtactt caaaaatgta       360
     gaaagggacc cacatttcgt ccttgatgtt cctcttggag tgatcagcag agtggagaag       420
     attggtgcac agagccatgg ggataatt                                          448
//


spacer
spacer