Dbfetch

ID   AY099894; SV 1; linear; mRNA; STD; MUS; 370 BP.
XX
AC   AY099894;
XX
DT   18-SEP-2002 (Rel. 73, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin-related 1 isoform B (Mtmr1) mRNA, partial cds;
DE   alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-370
RX   DOI; 10.1093/hmg/11.19.2297.
RX   PUBMED; 12217958.
RA   Buj-Bello A., Furling D., Tronchere H., Laporte J., Lerouge T.,
RA   Butler-Browne G.S., Mandel J.L.;
RT   "Muscle-specific alternative splicing of myotubularin-related 1 gene is
RT   impaired in DM1 muscle cells";
RL   Hum. Mol. Genet. 11(19):2297-2307(2002).
XX
RN   [2]
RP   1-370
RA   Buj-Bello A., Mandel J.-L.;
RT   ;
RL   Submitted (25-APR-2002) to the INSDC.
RL   Human Genetics, IGBMC, 1, rue Laurent Fries, Illkirch 67404, France
XX
DR   MD5; d9c80d5c293163d28d77df13ceaaa8e5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..370
FT                   /organism="Mus musculus"
FT                   /chromosome="X"
FT                   /map="Xq28"
FT                   /mol_type="mRNA"
FT                   /cell_line="C2C12"
FT                   /db_xref="taxon:10090"
FT   CDS             <1..>370
FT                   /codon_start=1
FT                   /gene="Mtmr1"
FT                   /product="myotubularin-related 1 isoform B"
FT                   /note="alternatively spliced"
FT                   /db_xref="GOA:Q8CIU7"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR030564"
FT                   /db_xref="InterPro:IPR030587"
FT                   /db_xref="MGI:MGI:1858271"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CIU7"
FT                   /protein_id="AAM21904.1"
FT                   /translation="HVEWCKQLIAATISSQISGSVTSENVSRDYKVFRRPDTRALRDGN
FT                   KLAQMEEAPLFPGESIKAIVKDVIYICPFMGAVSGTLTVTDFKMYFKNVERDPHFVLDV
FT                   PLGVISRVEKIGAQSHGDN"
FT   exon            94..117
FT                   /gene="Mtmr1"
FT                   /number=2.1
FT                   /note="alternatively spliced"
XX
SQ   Sequence 370 BP; 113 A; 64 C; 95 G; 98 T; 0 other;
     catgttgaat ggtgtaaaca gcttatagct gctacaattt ctagtcagat ttcaggttca        60
     gtgacatcag aaaatgtgtc aagagattac aaggttttca ggaggcctga taccagggct       120
     ctaagggatg gaaataaact ggcacagatg gaagaagctc cacttttccc aggagaatca       180
     attaaggcca ttgtgaaaga cgtcatttat atctgtccat ttatgggagc agtgagtggg       240
     accctgacag tgacggactt taaaatgtac ttcaaaaatg tagaaaggga cccacatttc       300
     gtccttgatg ttcctcttgg agtgatcagc agagtggaga agattggtgc acagagccat       360
     ggggataatt                                                              370
//