spacer

EBI Dbfetch

ID   AY090565; SV 1; linear; mRNA; STD; MUS; 2638 BP.
XX
AC   AY090565;
XX
DT   04-JAN-2003 (Rel. 74, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus neuronal tryptophan hydroxylase (Ntph) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2638
RX   DOI; 10.1126/science.1078197.
RX   PUBMED; 12511643.
RA   Walther D.J., Peter J.U., Bashammakh S., Hortnagl H., Voits M., Fink H.,
RA   Bader M.;
RT   "Synthesis of serotonin by a second tryptophan hydroxylase isoform";
RL   Science 299(5603):76-76(2003).
XX
RN   [2]
RP   1-2638
RA   Walther D.J., Bader M.;
RT   ;
RL   Submitted (19-MAR-2002) to the INSDC.
RL   Hypertension Research, Max-Delbrueck-Center for Molecular Medicine,
RL   Robert-Roessle-Strasse 10, Berlin-Buch, Berlin D-13092, Germany
XX
DR   MD5; 54d95b7719d7be654dc2d1730076fbbd.
DR   Ensembl-Gn; ENSMUSG00000006764; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006949; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2638
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             134..1600
FT                   /codon_start=1
FT                   /gene="Ntph"
FT                   /product="neuronal tryptophan hydroxylase"
FT                   /db_xref="GOA:Q8CGV2"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005963"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019773"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="MGI:MGI:2651811"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8CGV2"
FT                   /protein_id="AAM08923.1"
FT                   /translation="MQPAMMMFSSKYWARRGLSLDSAVPEDHQLLGSLTQNKAIKSEDK
FT                   KSGKEPGKGDTTESSKTAVVFSLKNEVGGLVKALRLFQEKHVNMLHIESRRSRRRSSEV
FT                   EIFVDCECGKTEFNELIQLLKFQTTIVTLNPPESIWTEEEDLEDVPWFPRKISELDRCS
FT                   HRVLMYGTELDADHPGFKDNVYRQRRKYFVDVAMGYKYGQPIPRVEYTEEETKTWGVVF
FT                   RELSKLYPTHACREYLKNLPLLTKYCGYREDNVPQLEDVSMFLKERSGFTVRPVAGYLS
FT                   PRDFLAGLAYRVFHCTQYVRHGSDPLYTPEPDTCHELLGHVPLLADPKFAQFSQEIGLA
FT                   SLGASDEDVQKLATCYFFTIEFGLCKQEGQLRAYGAGLLSSIGELKHALSDKACVKSFD
FT                   PKTTCLQECLITTFQDAYFVSDSFEEAKEKMRDFAKSITRPFSVYFNRYTQSIEILKDT
FT                   RSIENVVQDLRSDLNTVCDALNKMNQYLGI"
XX
SQ   Sequence 2638 BP; 757 A; 590 C; 630 G; 661 T; 0 other;
     cactgctctt cagcaccagg gttctggaca gcgccccgag caggcagctg ccactgcagt        60
     tcctccttca tctctgccaa ggccgcccct ctggtccccc ctgctgctga gaaagaaaat       120
     tacatcggga gccatgcagc ccgcaatgat gatgttttcc agtaaatact gggccaggag       180
     agggttgtcc ttggattctg ctgtgccaga agatcatcag ctacttggca gcttaacaca       240
     aaataaggct atcaaaagcg aggacaagaa aagcggcaaa gagcccggca aaggcgacac       300
     cacagagagc agcaagacag cagttgtgtt ctccttgaag aatgaagttg gtgggctggt       360
     gaaagcactt agactattcc aggaaaaaca tgtcaacatg cttcatatcg aatccaggcg       420
     gtcccggcga agaagttctg aagtcgaaat cttcgtggac tgcgaatgtg gcaaaacgga       480
     attcaatgag ctcatccagt tgctgaaatt tcagaccacc attgtgaccc tgaatccgcc       540
     tgagagcatt tggacggagg aagaagatct cgaggatgtg ccgtggttcc ctcggaagat       600
     ctctgagtta gacagatgct ctcaccgagt cctcatgtac ggcaccgagc ttgatgccga       660
     ccatccagga tttaaggaca atgtctatcg acagaggagg aagtattttg tggatgtggc       720
     catgggctat aaatatggtc agcccattcc cagggtcgag tacacagaag aagagactaa       780
     aacttggggt gttgtgttcc gggagctctc caaactctac ccgactcatg cttgccggga       840
     gtacctgaaa aacctccccc tgctgaccaa gtactgtggc tacagggaag acaacgtgcc       900
     gcaactggaa gacgtctcca tgtttctgaa agagcgatct ggcttcacag tgagaccagt       960
     ggctggctac ctgagcccaa gagacttcct ggcgggcctg gcctacagag tattccactg      1020
     cacccagtac gtgcggcatg gctccgaccc cctctacacc ccggaaccag atacatgcca      1080
     tgaactcttg ggacacgtgc cactgcttgc ggatcccaag tttgctcagt tttcccaaga      1140
     gataggctta gcgtctctgg gagcctcaga tgaggacgtt cagaaactag ccacgtgcta      1200
     tttcttcaca atcgagttcg gcctttgcaa gcaagagggt caactgcggg cgtatggagc      1260
     agggttactt tcgtccatcg gagaattgaa gcatgctctt tccgacaagg cgtgtgtgaa      1320
     atcctttgac ccaaagacga cctgcttgca ggaatgccta atcaccacct ttcaggacgc      1380
     ttactttgtt tcggacagtt ttgaagaagc caaagaaaag atgagggact ttgcaaagtc      1440
     aattacccgt cccttctcgg tatacttcaa ccgctacacg cagagcattg aaattctgaa      1500
     agacaccaga agtattgaga atgtggtgca ggacctgcgc agtgatttga acacagtgtg      1560
     tgatgccttg aataaaatga accaatatct ggggatttga tgcctagaac cagagttatt      1620
     gtcagcatga gctcttgggg ggtgtagcaa caatgcagtc aatgttatcc aacatcaaca      1680
     actttctgtg tcatggttgg ctagtaagca tgcaattctg tatgtccata cctctgtgta      1740
     acttaataac acaaaaatgc tctaaagaac ccatgcagat aaccactcac catttgaaag      1800
     attgtgatcc tatttggaca tctcaagtag agttgacatt tctgattagc gaacaaactg      1860
     ttaacttaag caaactgtga ctttgaaatc tgtagcaaac attcctcgca caattccagt      1920
     cggtgagttg tggaactttt cttccttgga cctgagactt tcctctgtgt tcattagata      1980
     aaatgaaaat agttgggagg tggtttctat tttcaatagt atccgtgtta tttgagataa      2040
     actagagttg ctccacgctt tgcatcacag caacaaagga tttaatattc tacttcagaa      2100
     gctgttcaga aacacagcag ttgggatgga tgtagactga gtgttcagac aatgcaagca      2160
     aagaaaagtt ttgataaaca ggatatatag gttgtactga cctcgttgaa accaatttgt      2220
     ggcaagcttc ctgaagagct tctggaagga aacacttgaa caaagaatat tcgggaagct      2280
     taaacagaag ggatgaaaat cttggaactg tgaatgtatt gttaggatag agtgaattat      2340
     cactgcaggc ttttgactcc ttttgcttag actgagaacc tcaaatccca cagggatgta      2400
     aataccatct ctgattccaa agagttggag acggagtcgt agagaaacaa agggatttgc      2460
     ttcagttagg tctgatgaga tgtgccatgg tcataagcca ctgccctttt atgttggaca      2520
     tctgacaagt ctactgtagt gtacatgcat gtttatgtat tgacacagaa agaaaattat      2580
     tgcttataaa atgaatgctt ctcaataaac agaatcttgc ccccaaaaaa aaaaaaaa        2638
//


spacer
spacer