Dbfetch

ID   AY066019; SV 1; linear; genomic DNA; STD; HUM; 4830 BP.
XX
AC   AY066019;
XX
DT   28-DEC-2001 (Rel. 70, Created)
DT   14-NOV-2006 (Rel. 89, Last updated, Version 2)
XX
DE   Homo sapiens tumor necrosis factor (TNF superfamily, member 2) (TNF) gene,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-4830
RA   Rieder M.J., Carrington D.P., Chung M.-W., Lee K.L., Poel C.L., Yi Q.,
RA   Nickerson D.A.;
RT   ;
RL   Submitted (10-DEC-2001) to the INSDC.
RL   Molecular Biotechnology, University of Washington, 1705 NE Pacific,
RL   Seattle, WA 98195, USA
XX
DR   MD5; 74a23ee55267d74ca5eb6cee6fa0edd3.
DR   EPD; EP11158; HS_TNF.
DR   Ensembl-Gn; ENSG00000204490; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206439; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223952; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228321; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228849; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230108; homo_sapiens.
DR   Ensembl-Gn; ENSG00000232810; homo_sapiens.
DR   Ensembl-Tr; ENST00000376122; homo_sapiens.
DR   Ensembl-Tr; ENST00000383496; homo_sapiens.
DR   Ensembl-Tr; ENST00000412275; homo_sapiens.
DR   Ensembl-Tr; ENST00000420425; homo_sapiens.
DR   Ensembl-Tr; ENST00000443707; homo_sapiens.
DR   Ensembl-Tr; ENST00000448781; homo_sapiens.
DR   Ensembl-Tr; ENST00000449264; homo_sapiens.
DR   EuropePMC; PMC3209447; 21985478.
XX
CC   To cite this work please use:  SeattleSNPs. NHLBI Program for
CC   Genomic Applications, UW-FHCRC, Seattle, WA (URL:
CC   http://pga.mbt.washington.edu).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4830
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   variation       214
FT                   /replace="a"
FT                   /frequency=".02"
FT   variation       282
FT                   /replace="a"
FT                   /frequency=".19"
FT   variation       346
FT                   /replace="a"
FT                   /frequency=".01"
FT   variation       352
FT                   /replace="a"
FT                   /frequency=".06"
FT   variation       657
FT                   /replace="g"
FT                   /frequency=".01"
FT   mRNA            join(689..955,1562..1607,1795..1842,2144..3363)
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT   CDS             join(770..955,1562..1607,1795..1842,2144..2565)
FT                   /codon_start=1
FT                   /gene="TNF"
FT                   /product="tumor necrosis factor (TNF superfamily, member
FT                   2)"
FT                   /db_xref="GOA:P01375"
FT                   /db_xref="HGNC:HGNC:11892"
FT                   /db_xref="InterPro:IPR002959"
FT                   /db_xref="InterPro:IPR006052"
FT                   /db_xref="InterPro:IPR006053"
FT                   /db_xref="InterPro:IPR008983"
FT                   /db_xref="InterPro:IPR021184"
FT                   /db_xref="PDB:1A8M"
FT                   /db_xref="PDB:1TNF"
FT                   /db_xref="PDB:2AZ5"
FT                   /db_xref="PDB:2E7A"
FT                   /db_xref="PDB:2TUN"
FT                   /db_xref="PDB:2ZJC"
FT                   /db_xref="PDB:2ZPX"
FT                   /db_xref="PDB:3ALQ"
FT                   /db_xref="PDB:3IT8"
FT                   /db_xref="PDB:3L9J"
FT                   /db_xref="PDB:3WD5"
FT                   /db_xref="PDB:4G3Y"
FT                   /db_xref="PDB:4TSV"
FT                   /db_xref="PDB:4TWT"
FT                   /db_xref="PDB:4Y6O"
FT                   /db_xref="PDB:5MU8"
FT                   /db_xref="PDB:5TSW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01375"
FT                   /protein_id="AAL47581.1"
FT                   /translation="MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGAT
FT                   TLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQW
FT                   LNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSY
FT                   QTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAE
FT                   SGQVYFGIIAL"
FT   variation       1009
FT                   /gene="TNF"
FT                   /replace="a"
FT                   /frequency=".04"
FT   variation       1078
FT                   /gene="TNF"
FT                   /replace="a"
FT                   /frequency=".05"
FT   repeat_region   1149..1190
FT                   /rpt_family="L2"
FT                   /rpt_type=DISPERSED
FT   variation       1278
FT                   /gene="TNF"
FT                   /replace=""
FT                   /frequency=".01"
FT   repeat_region   1378..1427
FT                   /rpt_family="L2"
FT                   /rpt_type=DISPERSED
FT   variation       1440
FT                   /gene="TNF"
FT                   /replace="g"
FT                   /frequency=".09"
FT   variation       1476
FT                   /gene="TNF"
FT                   /replace="c"
FT                   /frequency=".01"
FT   variation       1893
FT                   /gene="TNF"
FT                   /replace="g"
FT                   /frequency=".11"
FT   variation       2642
FT                   /gene="TNF"
FT                   /replace="c"
FT                   /frequency=".05"
FT   variation       2984
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".02"
FT   variation       3018
FT                   /gene="TNF"
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       3746
FT                   /replace="c"
FT                   /frequency=".03"
FT   repeat_region   3747..3922
FT                   /rpt_family="MIR"
FT                   /rpt_type=DISPERSED
FT   variation       4013
FT                   /replace="a"
FT                   /frequency=".03"
FT   repeat_region   4018..4154
FT                   /rpt_family="Alu"
FT                   /rpt_type=DISPERSED
FT   variation       4040
FT                   /replace="c"
FT                   /frequency=".03"
FT   variation       4101
FT                   /replace="a"
FT                   /frequency=".12"
FT   variation       4205
FT                   /replace="c"
FT                   /frequency=".01"
FT   variation       4231
FT                   /replace="a"
FT                   /frequency=".02"
FT   repeat_region   4317..4621
FT                   /rpt_family="Alu"
FT                   /rpt_type=DISPERSED
FT   variation       4366
FT                   /replace="a"
FT                   /frequency=".03"
FT   variation       4671
FT                   /replace="t"
FT                   /frequency=".01"
FT   variation       4711
FT                   /replace="a"
FT                   /frequency=".02"
FT   variation       4765
FT                   /replace="t"
FT                   /frequency=".09"
XX
SQ   Sequence 4830 BP; 1229 A; 1250 C; 1306 G; 1045 T; 0 other;
     ccaggcttgt ccctgctacc cccacccagc ctttcctgag gcctcaggcc tgccaccaag        60
     cccccagctc cttctccccg cagggaccca aacacaggcc tcaggactca acacagcttt       120
     tccctccaac cccgttttct ctccctcaag gactcagctt tctgaagccc ctcccagttc       180
     tagttctatc tttttcctgc atcctgtctg gaagttagaa ggaaacagac cacagacctg       240
     gtccccaaaa gaaatggagg caataggttt tgaggggcat ggggacgggg ttcagcctcc       300
     agggtcctac acacaaatca gtcagtggcc cagaagaccc ccctcggaat cggagcaggg       360
     aggatgggga gtgtgagggg tatccttgat gcttgtgtgt ccccaacttt ccaaatcccc       420
     gcccccgcga tggagaagaa accgagacag aaggtgcagg gcccactacc gcttcctcca       480
     gatgagctca tgggtttctc caccaaggaa gttttccgct ggttgaatga ttctttcccc       540
     gccctcctct cgccccaggg acatataaag gcagttgttg gcacacccag ccagcagacg       600
     ctccctcagc aaggacagca gaggaccagc taagagggag agaagcaact acagaccccc       660
     cctgaaaaca accctcagac gccacatccc ctgacaagct gccaggcagg ttctcttcct       720
     ctcacatact gacccacggc tccaccctct ctcccctgga aaggacacca tgagcactga       780
     aagcatgatc cgggacgtgg agctggccga ggaggcgctc cccaagaaga caggggggcc       840
     ccagggctcc aggcggtgct tgttcctcag cctcttctcc ttcctgatcg tggcaggcgc       900
     caccacgctc ttctgcctgc tgcactttgg agtgatcggc ccccagaggg aagaggtgag       960
     tgcctggcca gccttcatcc actctcccac ccaaggggaa atggagacgc aagagaggga      1020
     gagagatggg atgggtgaaa gatgtgcgct gatagggagg gatggagaga aaaaaacgtg      1080
     gagaaagacg gggatgcaga aagagatgtg gcaagagatg gggaagagag agagagaaag      1140
     atggagagac aggatgtctg gcacatggaa ggtgctcact aagtgtgtat ggagtgaatg      1200
     aatgaatgaa tgaatgaaca agcagatata taaataagat atggagacag atgtggggtg      1260
     tgagaagaga gatgggggaa gaaacaagtg atatgaataa agatggtgag acagaaagag      1320
     cgggaaatat gacagctaag gagagagatg ggggagataa ggagagaaga agatagggtg      1380
     tctggcacac agaagacact cagggaaaga gctgttgaat gcctggaagg tgaatacaca      1440
     gatgaatgga gagagaaaac cagacacctc agggctaaga gcgcaggcca gacaggcagc      1500
     cagctgttcc tcctttaagg gtgactccct cgatgttaac cattctcctt ctccccaaca      1560
     gttccccagg gacctctctc taatcagccc tctggcccag gcagtcagta agtgtctcca      1620
     aacctctttc ctaattctgg gtttgggttt gggggtaggg ttagtaccgg tatggaagca      1680
     gtgggggaaa tttaaagttt tggtcttggg ggaggatgga tggaggtgaa agtagggggg      1740
     tattttctag gaagtttaag ggtctcagct ttttcttttc tctctcctct tcaggatcat      1800
     cttctcgaac cccgagtgac aagcctgtag cccatgttgt aggtaagagc tctgaggatg      1860
     tgtcttggaa cttggagggc taggatttgg ggattgaagc ccggctgatg gtaggcagaa      1920
     cttggagaca atgtgagaag gactcgctga gctcaaggga agggtggagg aacagcacag      1980
     gccttagtgg gatactcaga acgtcatggc caggtgggat gtgggatgac agacagagag      2040
     gacaggaacc ggatgtgggg tgggcagagc tcgagggcca ggatgtggag agtgaaccga      2100
     catggccaca ctgactctcc tctccctctc tccctccctc cagcaaaccc tcaagctgag      2160
     gggcagctcc agtggctgaa ccgccgggcc aatgccctcc tggccaatgg cgtggagctg      2220
     agagataacc agctggtggt gccatcagag ggcctgtacc tcatctactc ccaggtcctc      2280
     ttcaagggcc aaggctgccc ctccacccat gtgctcctca cccacaccat cagccgcatc      2340
     gccgtctcct accagaccaa ggtcaacctc ctctctgcca tcaagagccc ctgccagagg      2400
     gagaccccag agggggctga ggccaagccc tggtatgagc ccatctatct gggaggggtc      2460
     ttccagctgg agaagggtga ccgactcagc gctgagatca atcggcccga ctatctcgac      2520
     tttgccgagt ctgggcaggt ctactttggg atcattgccc tgtgaggagg acgaacatcc      2580
     aaccttccca aacgcctccc ctgccccaat ccctttatta ccccctcctt cagacaccct      2640
     caacctcttc tggctcaaaa agagaattgg gggcttaggg tcggaaccca agcttagaac      2700
     tttaagcaac aagaccacca cttcgaaacc tgggattcag gaatgtgtgg cctgcacagt      2760
     gaagtgctgg caaccactaa gaattcaaac tggggcctcc agaactcact ggggcctaca      2820
     gctttgatcc ctgacatctg gaatctggag accagggagc ctttggttct ggccagaatg      2880
     ctgcaggact tgagaagacc tcacctagaa attgacacaa gtggacctta ggccttcctc      2940
     tctccagatg tttccagact tccttgagac acggagccca gccctcccca tggagccagc      3000
     tccctctatt tatgtttgca cttgtgatta tttattattt atttattatt tatttattta      3060
     cagatgaatg tatttatttg ggagaccggg gtatcctggg ggacccaatg taggagctgc      3120
     cttggctcag acatgttttc cgtgaaaacg gagctgaaca ataggctgtt cccatgtagc      3180
     cccctggcct ctgtgccttc ttttgattat gttttttaaa atatttatct gattaagttg      3240
     tctaaacaat gctgatttgg tgaccaactg tcactcattg ctgagcctct gctccccagg      3300
     ggagttgtgt ctgtaatcgc cctactattc agtggcgaga aataaagttt gcttagaaaa      3360
     gaaacatggt ctccttcttg gaattaattc tgcatctgcc tcttcttgtg ggtgggaaga      3420
     agctccctaa gtcctctctc cacaggcttt aagatccctc ggacccagtc ccatccttag      3480
     actcctaggg ccctggagac cctacataaa caaagcccaa cagaatattc cccatccccc      3540
     aggaaacaag agcctgaacc taattacctc tccctcaggg catgggaatt tccaactctg      3600
     ggaattccaa tccttgctgg gaaaatcctg cagctcaggt gagatttccg gctgttgcag      3660
     ctggccagca gtccggagag agctggagag gagccgcatt ctcaggtacc tgaatcacac      3720
     agccaaggga cttccagaga ttcgggtgtc taggcttcaa atcaccctgt cctaactctg      3780
     caacctgaac cagccactta acctatctat ccaatgggga taggaatgtc caccacacat      3840
     agggcatgtg agagaaggcc tgacctccat cagaggacct cactcagccc ttggcacagt      3900
     gggcacttag tgaattctgg cttccttcaa ccagtttcca gctgttctat ccccttccat      3960
     tctctcagtg ggtgaaatcg aagagactga ggacaataaa gaacaaggaa ccgaactgcc      4020
     ggacgtggtg gcatgcacct gtaatcctac cactttgcaa ggccaaggtg agaggatcgc      4080
     ttgaacccag gagttccaga gcaacctggg caacatagtg agatcctgtc tctatttttt      4140
     aaaaaagaat gaaacatagg aataagatgt gggtgaagga ctcacatgcc ggcttggtcc      4200
     cactggtctt tgtggtgaag gaggggagag gtgagaggtg ggtaatccgg aaagagaaaa      4260
     gcaccccctc cctggatgaa ggctcttctg gagagagtca aagacaaata agggtggggc      4320
     gcagtggctc atgcctgtta tcccaacact ttgggaggct gaggtgggag gaccacttga      4380
     gcccactagt tcaagaccag cctgtgcaac atagcaagac cttgtttcta gaaaaaaaat      4440
     taaagattag tcaggtgtag tggtgcatgc ctgtaatcct agctcctcag gaggctgagg      4500
     caggaggatc actcaagccc aggagtttga ggttacagta agctatgatc atgccactgt      4560
     acccccgtct gggtgacaga acgagaccct gtctcaaaaa aataataatt ccaaaaacaa      4620
     atatggagac ggaaattgag cccccctaga ctgggagccc ccactgagtt cggaaattag      4680
     gctttacctc cagccctggg gtgccaggca ggagaaaacc atgtggtagg ctgagggggt      4740
     agggtgaccc attggggtga cctagatagg gccttgggtc accctctgcc tcctccagcc      4800
     tgtggctgaa agtcagccat gaagtaatgg                                       4830
//