Dbfetch

ID   AY064488; SV 1; linear; mRNA; STD; MUS; 1092 BP.
XX
AC   AY064488;
XX
DT   10-DEC-2003 (Rel. 78, Created)
DT   10-DEC-2003 (Rel. 78, Last updated, Version 1)
XX
DE   Mus musculus G protein-coupled receptor (Gpr6) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1092
RX   DOI; 10.1016/j.bbrc.2003.10.006.
RX   PUBMED; 14592418.
RA   Ignatov A., Lintzel J., Kreienkamp H.J., Schaller H.C.;
RT   "Sphingosine-1-phosphate is a high-affinity ligand for the G
RT   protein-coupled receptor GPR6 from mouse and induces intracellular Ca2+
RT   release by activating the sphingosine-kinase pathway";
RL   Biochem. Biophys. Res. Commun. 311(2):329-336(2003).
XX
RN   [2]
RP   1-1092
RA   Lintzel J., Ignatov A., Schaller H.C.;
RT   ;
RL   Submitted (30-NOV-2001) to the INSDC.
RL   Institut fuer Entwicklungsneurobiologie, Zentrum fuer Molekulare
RL   Neurobiologie, Martinistrasse 52, Hamburg 20246, Germany
XX
DR   MD5; a02d4adb2ff68166730e4fc446772471.
DR   Ensembl-Gn; ENSMUSG00000046922; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017169; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017146; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017106; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017108; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016929; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017567; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016508; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016903; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017008; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017003; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017085; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017033; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017604; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016288; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016571; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000061796; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025022; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0024990; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0024951; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0024957; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0024768; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025468; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024314; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024703; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0024819; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0024818; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0024937; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0024811; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025507; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024030; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024316; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1092
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   gene            1..1092
FT                   /gene="Gpr6"
FT   CDS             1..1092
FT                   /codon_start=1
FT                   /gene="Gpr6"
FT                   /product="G protein-coupled receptor"
FT                   /db_xref="GOA:Q6YNI2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000723"
FT                   /db_xref="InterPro:IPR001151"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2155249"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6YNI2"
FT                   /protein_id="AAL40876.1"
FT                   /translation="MNASAAALNESQVVAVAAEGAAAAATAAGAPDTGEWGPPAASAAL
FT                   GGGGGPNGSLELSSQLPAGPSGLLLSAVNPWDVLLCVSGTVIAGENALVVALIASTPAL
FT                   RTPMFVLVGSLATADLLAGCGLILHFVFQYVVPSETVSLLMVGFLVASFAASVSSLLAI
FT                   TVDRYLSLYNALTYYSRRTLLGVHLLLAATWTVSLGLGLLPVLGWNCLADRTSCSVVRP
FT                   LTRSHVALLSTSFFVVFGIMLHLYVRICQVVWRHAHQIALQQHCLAPPHLAATRKGVGT
FT                   LAVVLGTFGASWLPFAIYCVVGSQEDPAIYTYATLLPATYNSMINPIIYAFRNQEIQRA
FT                   LWLLFCGCFQSKVPFRSRSPSEV"
XX
SQ   Sequence 1092 BP; 167 A; 349 C; 326 G; 250 T; 0 other;
     atgaacgcta gcgccgccgc gctcaacgag tcccaagtgg tggcagtagc ggccgaggga        60
     gcggcagctg cggctacagc agcaggggca ccggacaccg gcgaatgggg acccccagca       120
     gcatccgcag cgctgggagg cggcggcgga cctaacgggt cactggagct gtcttctcag       180
     ctgccagcag ggccctcggg actactgctt tcggcagtga atccctggga tgtgctgctg       240
     tgcgtgtcgg gaactgtgat cgcaggcgaa aatgcgctgg tggtggcgct catcgcgtcc       300
     actcccgcgc tgcgcacgcc catgtttgtg ctcgtgggta gtctggccac tgctgacctg       360
     ttggcgggct gtggcctcat cttacacttc gtgttccagt acgtggtgcc ctcggagact       420
     gtgagcctgc tcatggtggg cttcctggtg gcgtcctttg ccgcctcagt cagcagcctg       480
     cttgctatca cagtggaccg ttacctgtct ttgtacaacg cgctcaccta ctactcgcgc       540
     cggaccctgt tgggcgtgca cctcttgcta gcagccacct ggacagtgtc cctcgggttg       600
     gggttgctgc ctgttctagg ctggaactgc ttggccgacc gcacgtcctg cagcgtggtg       660
     cgccccctga cacgcagcca tgtggcgttg ctctctactt ccttcttcgt ggtctttggc       720
     atcatgctgc acttgtacgt gcgcatctgc caggtggtct ggcgccacgc ccaccagatc       780
     gctttgcaac agcattgcct agcaccgccc cacttagcag ccaccagaaa gggagtggga       840
     actttggccg tggtgctagg cacttttggg gccagctggc tgcccttcgc catctattgt       900
     gtggtgggta gccaagagga cccggccatc tacacttatg ccaccctgtt gcctgccacc       960
     tataactcca tgatcaatcc catcatctat gccttccgca accaggagat ccagcgtgcc      1020
     ttgtggctcc tgttctgtgg ctgtttccaa tccaaagtgc ccttccgctc caggtccccc      1080
     agtgaggtct ga                                                          1092
//