spacer

EBI Dbfetch

ID   AY055832; SV 1; linear; mRNA; STD; MUS; 3104 BP.
XX
AC   AY055832;
XX
DT   03-JAN-2002 (Rel. 70, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Mus musculus myotubularin-related protein 2 (Mtmr2) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3104
RX   DOI; 10.1016/S0378-1119(01)00876-9.
RX   PUBMED; 11867209.
RA   Bolino A., Marigo V., Ferrera F., Loader J., Romio L., Leoni A.,
RA   Di Duca M., Cinti R., Cecchi C., Feltri M.L., Wrabetz L., Ravazzolo R.,
RA   Monaco A.P.;
RT   "Molecular characterization and expression analysis of Mtmr2, mouse
RT   homologue of MTMR2, the Myotubularin-related 2 gene, mutated in CMT4B";
RL   Gene 283(1-2):17-26(2002).
XX
RN   [2]
RP   1-3104
RA   Bolino A., Monaco A.P.;
RT   ;
RL   Submitted (13-SEP-2001) to the INSDC.
RL   Laboratorio di Genetica Molecolare, Gaslini Institute, Largo Gaslini 5,
RL   Genova 16148, Italy
XX
DR   MD5; 6a990fe7fe5df0fa7283514f8f9cd6d5.
DR   Ensembl-Gn; ENSMUSG00000031918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034396; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3104
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   5'UTR           <1..911
FT                   /gene="Mtmr2"
FT   CDS             912..2843
FT                   /codon_start=1
FT                   /gene="Mtmr2"
FT                   /product="myotubularin-related protein 2"
FT                   /note="dual specificity phosphatase; belongs to the
FT                   myotubularin-related family of protein phosphatases"
FT                   /db_xref="GOA:Q9Z2D1"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR010569"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1924366"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2D1"
FT                   /protein_id="AAL14198.1"
FT                   /translation="MEKSSSCESLGAQLPAARLPSEDSLSSASTSHSENSVHTKSASAI
FT                   SSDSISTSADNFSPDLRVLREANKLAEMEEPALLPGENIKDMAKDVTYICPFTGAVRGT
FT                   LTVTSYRLYFKSMERDPPFVLDASLGVISRVEKIGGASSRGENSYGLETVCKDIRNLRF
FT                   AHKPEGRTRRSIFENLMKYAFPVSNGLPLFAFEYKEVFPENGWKLYDPLLEYRRQGIPN
FT                   ESWRITKINERYELCDTYPALLVVPANIPDEELKRVASFRSRGRIPVLSWIHPESQATV
FT                   TRCSQPMVGVSGKRSKEDEKYLQAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESE
FT                   DAYQNAELVFLDIHNIHVMRESLRKLKEIVYPTIEETHWLSNLESTHWLEHIKLILAGA
FT                   LRIADKVESGKTSVVVHCSDGWDRTAQLTSLAMLMLDGYYRTIRGFEVLVEKEWLSFGH
FT                   RFQLRVGHGDKNHADADRXPVFLQFIDCVWQMTRQFPTAFEFNEYFLITILDHLYSCLF
FT                   GTFLCNSEQQRGKENLPKKTVSLWSYINSQLEDFTNPLYGSYSNHVLYPVASMRHLELW
FT                   VGYYIRWNPRMKPQEPIHSRYKELLAKRAELQRKVEELQREISNRSTSSSERASSPAQC
FT                   VTPVQTVV"
FT   3'UTR           2844..>3104
FT                   /gene="Mtmr2"
XX
SQ   Sequence 3104 BP; 813 A; 756 C; 701 G; 833 T; 1 other;
     tctttttgtg attttagcag cttctccctc attctcactt caatacttac tatgccttat        60
     aggttggtgt caatgtgctt atcagctaca gacacacttt caagccactt taacccatac       120
     ttttgtcact ggaggcctga aaattcaact ccattctcac tttcctttgt ataacgctgt       180
     tcagagatgg aaatttccct tcccctcccc attcagggta gctgttacta tctttctcct       240
     acaaaccact tgttagtggt ctgtcatcct ttagttttct ttcattaaca gttaccattt       300
     attaagtttg ttaggttgtt tatatattga ctactgtctg agtgcttaag caggcattgc       360
     tttaggcgtt ttatatttat caatagttat tctgtgaggt taatatactt acacagaagg       420
     aagcagatgt aaatgcaagg taactggagg ccgtgggatc agtctgctta gcttcactgt       480
     taccgttaca aaatgggttc tcacatcacg tatgatctca catcactact tctaccctca       540
     cccttaaata cctcaccccc tcatcccaca ggccgcccac attcctctca ttttcctcga       600
     gtccacctct cccaagccgt cacatcttgt gttttctctg acatactagt gtcctcttcc       660
     ttctggagat tttcctgtta gctgactctc actgggcggc caggcgcatg cgcatcgctc       720
     cgctttgtag cgccacgggg cccgactccc gacagccccc gcgcgcagtg caggctgggg       780
     gaacatggcc gcttccggtc tcggagcctg cctggcgcgg ggctgaccgc ggctgcggcc       840
     ccgtgcgctc ctccctctgc atctcgcgcc ggcggccgcg gagggcgcag cggcctccag       900
     tttctcgcgc catggagaag agctccagct gcgagagtct cggcgcgcag ctcccggcgg       960
     caaggctgcc cagcgaggac tcactgtcca gtgcttctac ttctcattca gagaactcgg      1020
     tgcataccaa atcagcttct gctatatcat cagattccat ttcaacctct gcagacaact      1080
     tttctcctga cttgagggtc ctgagggagg caaacaagtt agcagaaatg gaggaaccag      1140
     ccctgcttcc aggagagaac attaaagata tggccaaaga tgtgacttac atatgtccat      1200
     tcactggtgc tgtgcgagga acgctgactg tcacaagtta caggttatat ttcaagagca      1260
     tggagcggga ccccccattt gttctagatg cttctcttgg agtgataagt agagtagaaa      1320
     aaattggtgg tgcatctagc cgaggtgaaa actcctatgg cctggaaact gtgtgcaagg      1380
     atatcaggaa cttgcgattt gctcataaac cggaggggcg aacaagaaga tccatatttg      1440
     agaatctaat gaaatatgca tttcctgtgt ctaatggctt gcctcttttt gcttttgagt      1500
     ataaagaagt attccccgaa aatgggtgga aactgtatga cccccttcta gagtacagaa      1560
     ggcagggaat tccaaatgaa agctggagaa taacaaagat aaatgaacgc tatgaactct      1620
     gtgacacata tcctgccctc ttggttgtgc cagcaaacat tcctgatgag gagctaaaga      1680
     gagtggcatc ctttaggtca cggggccgga tcccagtttt atcctggatt catcctgaaa      1740
     gtcaagccac agtcactcgc tgcagccagc ccatggttgg agtgagtggg aagcgcagca      1800
     aagaagatga gaagtacctt caggccatca tggactccaa tgcccagtct cacaaaatat      1860
     ttatctttga tgctcggcca agtgtcaatg cggttgccaa taaggcaaag gggggaggtt      1920
     atgaaagtga agatgcctat caaaatgcag aactcgtttt tctggatatt cataatatcc      1980
     atgttatgag agaatcatta cggaagctta aggagattgt gtaccccacc attgaagaaa      2040
     ctcactggtt gtctaactta gaatctacac actggctgga acacattaag ctcattcttg      2100
     caggggctct taggattgct gacaaggtcg agtctgggaa gacgtctgtg gtggtacact      2160
     gcagtgatgg atgggatcgc acagctcagc tcacttccct ggccatgctc atgttggatg      2220
     gatactaccg aaccatacga ggatttgaag tccttgtgga gaaagaatgg ctgagctttg      2280
     gacatagatt ccaactaaga gttggccatg gagataagaa ccatgctgac gcagacaggn      2340
     cacctgtttt ccttcagttt attgactgtg tctggcaaat gacaagacag ttccctaccg      2400
     catttgaatt caatgagtat tttctcatta ccatcctgga ccacttgtac agctgtttat      2460
     ttggaacatt cctttgtaac agcgaacagc agagggggaa agagaatctt cctaagaaga      2520
     cagtgtcact gtggtcctat ataaacagcc agctggaaga ctttactaat cctctttatg      2580
     gaagctactc caatcatgtc ctttacccag tagccagcat gcgccaccta gagctctggg      2640
     tgggatatta tataaggtgg aacccccgga tgaaacctca ggaacctatc cacagcagat      2700
     acaaagaact tcttgccaaa agagcagagc ttcaaagaaa agtagaggaa cttcagagag      2760
     aaatttccaa ccgctcaacc tcctcttcag agagagccag ctctcctgca cagtgtgtga      2820
     ctcctgtcca aactgttgta tgaaaggact aggcccaggg cctcattgcc aggaacctga      2880
     cattccagca ccttatgggt agaaaacctt ccgtgtttaa aacccatcta ctggagaatc      2940
     cttcggatgc tgtatttatt tcaaatctct cttagatgag tttagaaaca tagcagtgca      3000
     agtgacaatg aagatgatct cattcataat taaagtatga cactaatctt aagtcaccca      3060
     aagaatacta aagtactgca gtcctgtatt cacactggga gcaa                       3104
//


spacer
spacer