spacer

EBI Dbfetch

ID   AY052398; SV 1; linear; mRNA; STD; MUS; 1828 BP.
XX
AC   AY052398;
XX
DT   08-SEP-2004 (Rel. 81, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus uteroglobin receptor compete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1828
RA   Mukherjee A.B., Zhang Z., Chowdhury B.;
RT   "Mouse Uteroglobin Receptor";
RL   Unpublished.
XX
RN   [2]
RP   1-1828
RA   Mukherjee A.B., Zhang Z., Chowdhury B.;
RT   ;
RL   Submitted (24-AUG-2001) to the INSDC.
RL   HDB, NICHD, 9000 Rockville Pike, Bethesda, MD 20892, USA
XX
DR   MD5; 9255f8fc279b230f140afee512b45261.
DR   Ensembl-Gn; ENSMUSG00000022999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109127; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1828
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             21..1490
FT                   /codon_start=1
FT                   /product="uteroglobin receptor"
FT                   /db_xref="GOA:Q9D1E5"
FT                   /db_xref="InterPro:IPR006876"
FT                   /db_xref="InterPro:IPR008075"
FT                   /db_xref="MGI:MGI:1289247"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D1E5"
FT                   /protein_id="AAL13076.1"
FT                   /translation="MEAADYEVLSVREQLFHDRVRECIISILLFATLYILCHIFLTRFK
FT                   KPAEFTTVDDEDATVNKIALELCTFTLAVALGAVLLLPFSIISNEVLLSLPRNYYIQWL
FT                   NGSLIHGLWNLVFLFSNLSLVFLMPFAYFFTESEGFAGSRKGVLGRVYETVVMLILLTL
FT                   LVLGMVWVASAIVDNDKASRESLYDFWEYYLPYLYSCISFLGVLLLLVCTPLGLARMFS
FT                   VTGKLLVKPRLLEDLEEQLNCSAFEEAALTRRICNPTSCWLPLDMELLHRQVLALQAQR
FT                   VLLEKRRKASAWQRNLGYPLAMLCLLVLTGLSVLIVAVHILELLIDEAAMPRGMQDAAL
FT                   GQASFSKLGSFGAIIQVVLIFYLMVSSVVGFYSSPLFGSLRPRWHDTSMTQIIGNCVCL
FT                   LVLSSALPVFSRTLGLTRFDLLGDFGRFNWLGNFYIVFLYNAAFAGLTTLCLVKTFTAA
FT                   VRAELIRAFGLDRLPLPVSGFPRASRKKQHQ"
XX
SQ   Sequence 1828 BP; 339 A; 528 C; 494 G; 467 T; 0 other;
     ccagtcatgc tgagcagagt atggaagcag ctgactacga agtgctatcc gtgcgagaac        60
     agctgttcca cgacagggtc cgcgagtgca tcatctcaat acttctgttt gcaacactct       120
     acatcctctg ccatatcttc ctgacccgct tcaagaagcc tgctgagttc accacagtgg       180
     atgatgaaga tgccacagtt aacaagattg cgctggagct gtgcaccttt accctggcgg       240
     tcgccctggg cgccgtctta ctcctgccct tctccatcat cagcaacgag gtgctgctct       300
     cgttgccacg caactactac atccagtggc tcaatggctc cctcatccat ggtctgtgga       360
     acctcgtttt cctcttctcc aatctgtccc tcgtcttcct tatgcccttt gcatatttct       420
     tcacagagtc tgaaggcttt gctggctcca gaaagggtgt cctgggccgg gtctacgaga       480
     cagtggtgat gttgatcctc ctcacgctgc ttgtgctggg catggtgtgg gtggcatccg       540
     ccattgtaga caatgacaag gccagcaggg agtcgctcta cgacttctgg gagtactacc       600
     tcccctatct ctactcctgt atctccttcc tcggagttct gctgcttctg gtgtgcactc       660
     cactaggtct cgcccgcatg ttctctgtca ctgggaagtt gctggtcaag ccccggctac       720
     tggaagacct ggaggaacag ctgaactgct cagcctttga ggaggcagct ctgactcgaa       780
     gaatctgcaa tcccacctcc tgctggctgc cactggacat ggaactgctg catagacagg       840
     tcctggctct gcaggcacag agggtcctct tggaaaagcg tcggaaggcg tcagcctggc       900
     aacggaacct gggctaccct ctggccatgc tgtgcttgct ggtgctgacg ggcctgtctg       960
     tcctcatcgt ggctgtccac atcctggagc tgcttattga cgaggctgcc atgccacggg      1020
     gcatgcagga tgctgcccta ggccaggcct ccttctccaa actgggatcc tttggcgcca      1080
     tcatccaggt tgtgctgata ttttacctga tggtgtcctc agtggtgggt ttctacagct      1140
     ctccactctt tggaagcctg aggcctaggt ggcatgacac atcgatgaca cagatcattg      1200
     ggaactgtgt ctgcctcctg gtcctcagct cagcacttcc tgtcttctct agaactcttg      1260
     gcctgacacg ctttgacctg ctgggtgact ttggacgctt caactggcta ggcaatttct      1320
     acatcgtgtt cctctacaac gcagcctttg ctggcctcac cacactctgt ctggtgaaga      1380
     ccttcacggc agctgtgagg gcagagctga tccgagcctt tgggctggac agactgccac      1440
     tgcctgtctc tgggtttccc cgggcttcta ggaagaagca gcatcaatga cctccagctg      1500
     ggggctgaga aggagagaac tgggcagtgc ctaggcctgg cggtgagccc cagggggctg      1560
     cacctcagga cctggaacct gagagtaggt gacagagggg acggaccatc tgcactgttg      1620
     cttaatctga gccagagttt gggacccggc tggcctcctg ccttttcaga tgtagctgtg      1680
     gcctgagcat ccatctggtg gagctggggg actcgctcta gttcctggac ccaaatacgt      1740
     ttacacatct atctgcctca atcctgttcc aggccatgcc tgaagccatg tttacatgat      1800
     ttgatgtgca atagggtggg tgggactt                                         1828
//


spacer
spacer