spacer

EBI Dbfetch

ID   AY049786; SV 1; linear; mRNA; STD; HUM; 425 BP.
XX
AC   AY049786;
XX
DT   27-OCT-2001 (Rel. 69, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens synuclein alpha (SNCA) mRNA, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-425
RA   Hu X., Xu Y., Peng X., Yuan J., Qiang B.;
RT   ;
RL   Submitted (30-JUL-2001) to the INSDC.
RL   Department of Biochemistry, Institute of Basic Medical Science, Chinese
RL   Academy of Medical Sciences, 5 Dong Dan San Tiao, Beijing 100005, P.R.
RL   China
XX
DR   MD5; 6f94f05960e816051f66f25a15e331a3.
DR   Ensembl-Gn; ENSG00000145335; homo_sapiens.
DR   Ensembl-Tr; ENST00000336904; homo_sapiens.
DR   Ensembl-Tr; ENST00000345009; homo_sapiens.
DR   Ensembl-Tr; ENST00000394986; homo_sapiens.
DR   Ensembl-Tr; ENST00000394989; homo_sapiens.
DR   Ensembl-Tr; ENST00000394991; homo_sapiens.
DR   Ensembl-Tr; ENST00000420646; homo_sapiens.
DR   Ensembl-Tr; ENST00000505199; homo_sapiens.
DR   Ensembl-Tr; ENST00000506244; homo_sapiens.
DR   Ensembl-Tr; ENST00000508895; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..425
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             3..425
FT                   /codon_start=1
FT                   /gene="SNCA"
FT                   /product="synuclein alpha"
FT                   /note="non-A4 component of amyloid precursor"
FT                   /db_xref="GOA:P37840"
FT                   /db_xref="H-InvDB:HIT000083849.13"
FT                   /db_xref="HGNC:HGNC:11138"
FT                   /db_xref="InterPro:IPR001058"
FT                   /db_xref="InterPro:IPR002460"
FT                   /db_xref="PDB:1XQ8"
FT                   /db_xref="PDB:2JN5"
FT                   /db_xref="PDB:2KKW"
FT                   /db_xref="PDB:2M55"
FT                   /db_xref="PDB:2X6M"
FT                   /db_xref="PDB:3Q25"
FT                   /db_xref="PDB:3Q26"
FT                   /db_xref="PDB:3Q27"
FT                   /db_xref="PDB:3Q28"
FT                   /db_xref="PDB:3Q29"
FT                   /db_xref="PDB:4BXL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P37840"
FT                   /protein_id="AAL15443.1"
FT                   /translation="MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTK
FT                   EGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNE
FT                   EGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA"
XX
SQ   Sequence 425 BP; 136 A; 74 C; 141 G; 74 T; 0 other;
     ccatggatgt attcatgaaa ggactttcaa aggccaagga gggagttgtg gctgctgctg        60
     agaaaaccaa acagggtgtg gcagaagcag caggaaagac aaaagagggt gttctctatg       120
     taggctccaa aaccaaggag ggagtggtgc atggtgtggc aacagtggct gagaagacca       180
     aagagcaagt gacaaatgtt ggaggagcag tggtgacggg tgtgacagca gtagcccaga       240
     agacagtgga gggagcaggg agcattgcag cagccactgg ctttgtcaaa aaggaccagt       300
     tgggcaagaa tgaagaagga gccccacagg aaggaattct ggaagatatg cctgtggatc       360
     ctgacaatga ggcttatgaa atgccttctg aggaagggta tcaagactac gaacctgaag       420
     cctaa                                                                   425
//


spacer
spacer