Dbfetch

ID   AY043479; SV 1; linear; mRNA; STD; MUS; 2672 BP.
XX
AC   AY043479;
XX
DT   05-SEP-2001 (Rel. 69, Created)
DT   21-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus beta-1,3-N-acetylglucosaminyltransferase mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2672
RA   Egan S.E., Cohen B.L., Sarkar M., Ying Y., Cohen S., Singh N., Wang W.,
RA   Flock G., Goh T., Schachter H.;
RT   "Molecular cloning and expression analysis of a mouse
RT   UDP-GlcNAc:Gal(beta1-4)Glc(NAc)-R beta1,3-N-acetylglucosaminyltransferase
RT   homologous to Drosophila melanogaster Brainiac and the
RT   beta1,3-galactosyltransferase family";
RL   Glycoconj. J. 17:865-872(2000).
XX
RN   [2]
RP   1-2672
RA   Egan S.E., Cohen B.L., Sarkar M., Ying Y., Cohen S., Singh N., Wang W.,
RA   Flock G., Goh T., Schachter H.;
RT   ;
RL   Submitted (03-JUL-2001) to the INSDC.
RL   Programs in Cancer Research and Developmental Biology, The Hospital for
RL   Sick Children, 555 University Avenue, Toronto, ON M5G 1X8, Canada
XX
DR   MD5; 5b9dd85b288f9d9a6de72ea0b398fb5a.
DR   Ensembl-Gn; ENSMUSG00000051650; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018080; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018053; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018017; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018021; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017835; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018473; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017396; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017809; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017919; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017911; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017990; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017937; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018514; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017177; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017450; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000055549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062844; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028226; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0028191; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0028155; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028171; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028668; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027596; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0027897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0028025; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0028015; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0028138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027997; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027298; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027481; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2672
FT                   /organism="Mus musculus"
FT                   /strain="C.B17"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             210..1403
FT                   /codon_start=1
FT                   /product="beta-1,3-N-acetylglucosaminyltransferase"
FT                   /note="b3GnT"
FT                   /db_xref="GOA:Q9Z222"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:1889505"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z222"
FT                   /protein_id="AAK95359.1"
FT                   /translation="MSVGRRRVKLLGILMMANVFIYLIVEVSKNSSQDKNGKGGVIIPK
FT                   EKFWKPPSTPRAYWNREQEKLNRWYNPILNRVANQTGELATSPNTSHLSYCEPDSTVMT
FT                   AVTDFNNLPDRFKDFLLYLRCRNYSLLIDQPKKCAKKPFLLLAIKSLIPHFARRQAIRE
FT                   SWGRETNVGNQTVVRVFLLGKTPPEDNHPDLSDMLKFESDKHQDILMWNYRDTFFNLSL
FT                   KEVLFLRWVSTSCPDAEFVFKGDDDVFVNTHHILNYLNSLSKSKAKDLFIGDVIHNAGP
FT                   HRDKKLKYYIPEVFYTGVYPPYAGGGGFLYSGPLALRLYSATSRVHLYPIDDVYTGMCL
FT                   QKLGLVPEKHKGFRTFDIEEKNKKNICSYIDLMLVHSRKPQEMIDIWSQLQSPNLKC"
XX
SQ   Sequence 2672 BP; 731 A; 562 C; 635 G; 744 T; 0 other;
     gaattcggca cgaggcggca acaagtgctg gagctgaggc gagccggagc cgcccagacc        60
     ccgccgggcc gcccgtccgc gcattgcgca tggagcgaga gcgcggcggt cgcggggctg       120
     agccgcaaga ccggctggga cgtggatgcg gccgcggtct tccgccccgc cccgccgagc       180
     tggaggtgtc cctagacaag gtatgagaga tgagtgtggg gcgtcgaaga gtcaagttgc       240
     tgggcatcct gatgatggca aatgtcttca tttatttgat tgtggaagtc tccaaaaaca       300
     gtagccaaga caaaaatgga aagggaggag taataatccc gaaagagaag ttctggaagc       360
     cacccagcac tccccgggca tactggaaca gggaacagga gaagctgaac aggtggtaca       420
     atcccatctt gaacagggtg gccaatcaga caggggagct agccacatct ccaaacacaa       480
     gtcacctgag ctattgtgaa ccagactcga cggtcatgac agctgtgaca gattttaata       540
     atctgccgga cagatttaaa gactttctct tgtatttgag atgccggaat tactcgctgc       600
     ttatagatca accgaagaaa tgtgcaaaga agcccttctt actattggcg ataaagtccc       660
     tcattccaca ttttgccaga aggcaagcaa ttcgggagtc ttggggccga gaaaccaacg       720
     tagggaacca gacagtagtg agggtcttcc tgttgggcaa gacaccccca gaggacaacc       780
     accctgacct ttcggacatg cttaagtttg agagtgacaa gcaccaggac atcctcatgt       840
     ggaactatag agacacattc ttcaacctgt ccctgaagga agtgctgttt cttaggtggg       900
     tgagcacttc ctgtccagac gcagagtttg tcttcaaggg cgatgatgac gtgtttgtga       960
     acacccatca catccttaat tacttgaata gcttatccaa gagcaaagcc aaagacttgt      1020
     tcataggtga cgtgatccac aatgctgggc ctcaccggga taagaaactg aagtactaca      1080
     tcccagaagt cttctacacc ggcgtctacc caccgtatgc cgggggtggt ggattcctgt      1140
     actccggccc ccttgccttg aggctgtaca gtgcgactag ccgggtccat ctctacccta      1200
     ttgatgatgt ttatacggga atgtgccttc agaaactggg ccttgttcca gagaagcaca      1260
     aaggcttcag gacatttgat attgaagaga aaaataagaa aaatatttgt tcctatatag      1320
     acctaatgtt agtacatagc agaaaacctc aagagatgat tgatatctgg tctcagttgc      1380
     aaagtcctaa tttaaaatgc tgaaatagac atgagctgca tttcacagaa aggcctagcc      1440
     tgactagttc ccatggtgtg ctctcacaat aggtgagttc tgtgtgaggc tattagcctt      1500
     catgagcagg tagcccctgg gctcccaagc cctcagtcct tcccttgcct tgtgaagagg      1560
     gaaggctgaa gacagctcag catggcaggg tgagtggtta tgacccttcc tctggctgcc      1620
     ggtcctcagt ttctaatttg ttttctttct cctccacaat tatgtatgta tgtgtgtata      1680
     tatgtgtgtg tgtacataca tacatatata tatatgtagg acacaacctg gtggctttgt      1740
     gaaatggaat tcctatgtat tttcataaga ttttgaaagt tgtctagaaa gtagactgat      1800
     gtcaatctcc cgtcacccag cagtattgtc cttgttacta gaaaccgtta cttcctttat      1860
     gcaaggaaag ccacgcaggc gtgtagttca tcttgtcagg gcttatggcc atgaggacag      1920
     aggggatttt ctttttactt gtgtttggtt tcctgggtgg catcatggta gttaacctat      1980
     ttttagtatt tgaagatcat gtgattccct aatggccaac tggagactga gtagcccgac      2040
     agccatgggt ctgtgagtgt tcagagactg ggaagcattc gccacttctg agctttggac      2100
     gtgattagtc agttaaaacc ccaagattct attcttgcca tattatcacg tattccttag      2160
     ataaaattct gggtagtgac acttccctgt ctcagtgtag aagtgcctgt gcttttattt      2220
     attgttcaga tcaaacacca aaacattttc ttaaaaaata ttttgtgtaa tattttattt      2280
     gtatacagtg tttgtgaaat atttaactag agcatgatat tttatttttt ctcattttta      2340
     attctttgag aatttcatac aatgtgtttt gattgtattc acctccccat ctcctcccag      2400
     atccagcatg atgttttaaa tgttaagctg taacatgtta gataaagtta actcttattt      2460
     ttgaatttta aaatttggat gggggggtat gaactgctag agaaaataaa gttctgccaa      2520
     aatattgcat atactagtat cttgtaacat gctttcttga aatatttttg tgctttagag      2580
     gggtctcacc tgtgctacag gggactggga aaagtggaat aaagtgattg tattttttaa      2640
     tcaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    2672
//