spacer

EBI Dbfetch

ID   AY039028; SV 1; linear; mRNA; STD; MUS; 1653 BP.
XX
AC   AY039028;
XX
DT   31-DEC-2004 (Rel. 82, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mus musculus core 1 beta-1,3-N-acetylglucosaminyltransferase mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1653
RA   Yeh J.-C., Fukuda M.;
RT   "Core 1 beta-1,3-N-acetylglucosaminyltransferase (Core1-beta3GlcNAcT)";
RL   Unpublished.
XX
RN   [2]
RP   1-1653
RA   Yeh J.-C., Fukuda M.;
RT   ;
RL   Submitted (07-JUN-2001) to the INSDC.
RL   Glycobiology, The Burnham Institute, 10901 North Torrey Pines Road, La
RL   Jolla, CA 92037, USA
XX
DR   MD5; 8b125437d2991d07481cf6f35b440171.
DR   Ensembl-Gn; ENSMUSG00000031803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034260; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1653
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             19..1137
FT                   /codon_start=1
FT                   /product="core 1 beta-1,3-N-acetylglucosaminyltransferase"
FT                   /note="Core1-beta3GlcNAcT; glycosyltransferase"
FT                   /db_xref="GOA:Q5JCS9"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:2152535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5JCS9"
FT                   /protein_id="AAK72481.1"
FT                   /translation="MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPED
FT                   NPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCA
FT                   EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLL
FT                   ELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVT
FT                   YLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVA
FT                   ALRRAARVLPMFPIDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDL
FT                   LLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY"
XX
SQ   Sequence 1653 BP; 337 A; 523 C; 469 G; 324 T; 0 other;
     aggctccgcc cccacgccat gcggctgcca aggcagagcc cctacgagat cctcctcctg        60
     gtcttggtcg ccttgctggt gctgctgctg ctcctgacca gcaagtcacc gcccagctgc       120
     tccgcccctg agaggtccaa ggagcctgaa gacaaccccg ggtgggccac gggccaccca       180
     cgcacacacc ccgcccggtg ccgagctaat ctatccgtgt cctcgcaccc cgacttcgcg       240
     gggctgccct tgcacgtgcg cgacttcttg ttctaccgcc actgccgcga cttcccagtg       300
     ctccgagagc cgcgggttac caagtgcgcg gagcccgtgt tcctgctgct cgccatcaag       360
     tcctcgcctg caaactatgg gcgccgccag atgctgcgca cgacgtgggc gcgcgagaga       420
     cgggtgcgtg gggcgccact gcgccgcctc ttccttgtgg gctcagaccg cgacccacaa       480
     caagcacgca aatacaaccg actgctggag ctggaagcgc agaaatacgg cgacattctc       540
     cagtgggatt tccatgactc cttctttaac ctgacgctta agcaggtcct tttcctggag       600
     tggcagctaa cctactgtac caacgccagc ttcgtgctca atggggacga cgatgtgttc       660
     gcacacacgg acaacatggt cacctacctg caggaccacg acccggacca acacctcttc       720
     gtggggcacc tgatccagaa cgtgggtccc atccgggtgc cctggagcaa gtacttcatc       780
     cccgctctgg tgatggcgga ggacagatac ccgccctact gtggtggcgg cggcttcctg       840
     ctgtcgcgtt ttaccgtggc cgccctacgt cgcgccgcgc gcgtcctccc catgttccca       900
     atcgacgacg tgttcctggg catgtgtctg cagcagcagg gtctggctcc cgggacgcac       960
     agcggagtgc gcactgcggg ggttttcccc cctagcccac gtgtgtcatc cttcgacccc      1020
     tgcttctacc gcgacctgct cctcgtgcac cgcttcctgc ccttcgagat gctgctgatg      1080
     tgggatgcgc tgaaccagcc ccagctcctc tgcggcaggc agagccccgc ctactgagag      1140
     gtttggggga gttgacatcc cctagctcat gtcctgcctc atccacgtgc aaagggctgg      1200
     cttcaaggag aagttcaaag tgaggggcag aaaggtgggt ctgaggagtt catagggcaa      1260
     actcctaagt acgcttggaa accctcttgg tactgttcac agcaggaact ctgagtctag      1320
     ccaactctga gtggctctaa gtggccgcta agcaaaaact gctgtggaca gagcccatgg      1380
     gttttaggct ctgggccttg gcctctctca ggcccccaag gaattgggca gaggaacaag      1440
     gtggatttta aactgaggtg ctcagagatc ttgacttgac ccccactagt gtctcccaag      1500
     aacttggaga accacagggg caggaggggt cctgtgtccc acagaccggg ctggcaggaa      1560
     ataaagtcca tagaaggttg aacgtgattg tagggggaag gttaagataa aactcagggc      1620
     tctgccaaaa aaaaaaaaaa aaaaaaaaaa aaa                                   1653
//


spacer
spacer