spacer

EBI Dbfetch

ID   AY037785; SV 1; linear; mRNA; STD; MUS; 1732 BP.
XX
AC   AY037785;
XX
DT   06-JUL-2001 (Rel. 68, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Mus musculus beta1,3 N-acetylglucosaminyltransferase-3 (B3gnt3) mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1732
RA   Zhou D., Hennet T.;
RT   "Mouse beta1,3 N-acetylglucosaminyltransferase-3";
RL   Unpublished.
XX
RN   [2]
RP   1-1732
RA   Zhou D., Hennet T.;
RT   ;
RL   Submitted (31-MAY-2001) to the INSDC.
RL   Physiology, University of Zurich, Winterthurerstrasse 190, Zurich 8057,
RL   Switzerland
XX
DR   MD5; 8c0a9af3f5bd9c5b709a2a05421df2c4.
DR   Ensembl-Gn; ENSMUSG00000031803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034260; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1732
FT                   /organism="Mus musculus"
FT                   /strain="129/Sv"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS             69..1187
FT                   /codon_start=1
FT                   /gene="B3gnt3"
FT                   /product="beta1,3 N-acetylglucosaminyltransferase-3"
FT                   /note="glycosyltransferase"
FT                   /db_xref="GOA:Q5JCS9"
FT                   /db_xref="InterPro:IPR002659"
FT                   /db_xref="MGI:MGI:2152535"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5JCS9"
FT                   /protein_id="AAK68855.1"
FT                   /translation="MRLPRQSPYEILLLVLVALLVLLLLLTSKSPPSCSAPERSKEPED
FT                   NPGWATGHPRTHPARCRANLSVSSHPDFAGLPLHVRDFLFYRHCRDFPVLREPRVTKCA
FT                   EPVFLLLAIKSSPANYGRRQMLRTTWARERRVRGAPLRRLFLVGSDRDPQQARKYNRLL
FT                   ELEAQKYGDILQWDFHDSFFNLTLKQVLFLEWQLTYCTNASFVLNGDDDVFAHTDNMVT
FT                   YLQDHDPDQHLFVGHLIQNVGPIRVPWSKYFIPALVMAEDRYPPYCGGGGFLLSRFTVA
FT                   AIRRAARVLPMFPVDDVFLGMCLQQQGLAPGTHSGVRTAGVFPPSPRVSSFDPCFYRDL
FT                   LLVHRFLPFEMLLMWDALNQPQLLCGRQSPAY"
XX
SQ   Sequence 1732 BP; 331 A; 548 C; 490 G; 363 T; 0 other;
     atgctgctgc catgctccca ccttgatggt aatggactga acctctgaac ctgctccgcc        60
     cccacgccat gcggctgcca aggcagagcc cctacgagat cctcctcctg gtcttggtcg       120
     ccttgctggt gctgctgctg ctcctgacca gcaagtcacc gcccagctgc tctgcccctg       180
     agaggtccaa ggagcctgaa gacaaccccg ggtgggccac gggccaccca cgcacacacc       240
     ccgcccggtg ccgagctaat ctatccgtgt cctcgcaccc cgacttcgcg gggctgccct       300
     tacacgtgcg cgacttcttg ttctaccgcc actgccgcga cttcccagtg ctccgagagc       360
     cgcgggttac caagtgcgcg gagcccgtgt tcctgctgct cgccatcaag tcctcgcctg       420
     caaactatgg gcgccgccag atgctgcgca cgacgtgggc gcgcgagaga cgggtgcgtg       480
     gggcgccact gcgccgcctc ttccttgtgg gctcagaccg cgacccacaa caagcacgca       540
     aatacaaccg actgctggag ctggaagcgc agaaatacgg cgacattctc cagtgggatt       600
     tccatgactc cttctttaac ctgacgctta agcaggtcct tttcctggag tggcagctaa       660
     cctactgtac caacgccagc ttcgtgctca atggggacga cgatgtgttc gcacacacgg       720
     acaacatggt cacctacctg caggaccacg acccggacca acacctcttc gtggggcacc       780
     tgatccagaa cgtgggtccc atccgggtgc cctggagcaa gtacttcatc cccgctctgg       840
     tgatggcgga ggacagatac ccgccctact gtggtggcgg cggcttcctg ctgtcgcgtt       900
     ttaccgtggc cgccatacgt cgcgccgcgc gcgtcctccc catgttccca gtcgacgacg       960
     tgttcctggg catgtgtctg cagcagcagg gtctggctcc cgggacgcac agcggagtgc      1020
     gcactgcggg ggttttcccc cctagcccac gtgtgtcatc cttcgacccc tgcttctacc      1080
     gcgacctgct cctcgtgcac cgcttcctgc ccttcgagat gctgctgatg tgggatgcgc      1140
     tgaaccagcc ccagctcctc tgcggcaggc agagccccgc ctactgagag gtttggggga      1200
     gttgacatcc cctagctcat gtcctgcctc atccacgtgc aaagggctgg cttcaaggag      1260
     aagttcaaag tgaggggcag aaaggtgggt ctgaggagtt catagggcaa actcctaagt      1320
     acgcttggaa accctcttgg tactgttcac agcaggaact ctgagtctag ccaactctga      1380
     gtggctctaa gtggccgcta agcaaaaact gctgtggaca gagcccatgg gttttaggct      1440
     ctgggccttg gcctctctca ggcccccaag gaattgggca gaggaacaag gtggatttta      1500
     aactgaggtg ctcagagatc ttgacttgac ccccactagt gtctcccaag aacttggaga      1560
     accacagggg caggaggggt cctgtgtccc acagaccggg ctggcaggaa ataaagtcca      1620
     tagaaggttg aacgtgattg tagggggaag gttaagataa aactcagggc tctgccacgt      1680
     tttaatttta tctatttagg aagggagcca ggtcctgtct tcctctctgt tt              1732
//


spacer
spacer