
ID   AY036896; SV 1; linear; genomic DNA; STD; HUM; 96 BP.
AC   AY036896;
DT   06-MAR-2002 (Rel. 71, Created)
DT   05-OCT-2002 (Rel. 73, Last updated, Version 2)
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*0604 allele,
DE   partial cds.
KW   .
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
RN   [1]
RP   1-96
RX   DOI; 10.1046/j.1365-2370.2002.00344.x.
RX   PUBMED; 12358858.
RA   Pascual M., Lopez-Nevot M.A., Caballero A., Alonso A., Zanelli E.,
RA   Martin J.;
RT   "Complete characterization of the DQB1 first exon polymorphism";
RL   Eur. J. Immunogenet. 29(5):447-448(2002).
RN   [2]
RP   1-96
RA   Pascual M., Zanelli E., Martin J.;
RT   ;
RL   Submitted (28-MAY-2001) to the INSDC.
RL   Immunology, Instituto de Parasitologia y Biomedicina 'Lopez-Neyra', CSIC.,
RL   Ventanilla 11, Granada 18001, Spain
DR   MD5; 8c8d736cecc8bfb27dbbadff433cca0d.
FH   Key             Location/Qualifiers
FT   source          1..96
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>96
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   CDS             1..>96
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /note="HLA-DQ-beta"
FT                   /db_xref="GOA:Q8SNB9"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNB9"
FT                   /protein_id="AAK96012.1"
FT                   /translation="MSWKKALRIPGDLRVATVTLMLAMLSSLLAEG"
SQ   Sequence 96 BP; 17 A; 25 C; 31 G; 23 T; 0 other;
     atgtcttgga agaaggcttt gcggatcccc ggagaccttc gggtagcaac tgtcaccttg        60
     atgctggcga tgctgagctc cctactggct gagggc                                  96