spacer

EBI Dbfetch

ID   AY035850; SV 1; linear; mRNA; STD; MUS; 1381 BP.
XX
AC   AY035850;
XX
DT   03-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus C57BL/6J adipose differentiation-related protein mRNA,
DE   complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1381
RX   PUBMED; 11978849.
RA   Fehr C., Shirley R.L., Belknap J.K., Crabbe J.C., Buck K.J.;
RT   "Congenic mapping of alcohol and pentobarbital withdrawal liability loci to
RT   a <1 centimorgan interval of murine chromosome 4: identification of Mpdz as
RT   a candidate gene";
RL   J. Neurosci. 22(9):3730-3738(2002).
XX
RN   [2]
RP   1-1381
RA   Fehr C., Belknap J.K., Crabbe J.C., Buck K.J.;
RT   ;
RL   Submitted (16-MAY-2001) to the INSDC.
RL   Department of Behavioral Neuroscience, Portland Alcohol Research Center,
RL   Oregon Health Sciences University and Veterans Affairs Medical Center
RL   Portland (Research Services), 3710 SW US Veterans Hospital Road, Portland,
RL   OR 97201, USA
XX
DR   MD5; 2ac60779edc4bbe4f84b93b0dafd3b80.
DR   Ensembl-Gn; ENSMUSG00000028494; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000466; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1381
FT                   /organism="Mus musculus"
FT                   /chromosome="4"
FT                   /map="38.9 cM"
FT                   /strain="C57BL/6J"
FT                   /mol_type="mRNA"
FT                   /dev_stage="adult"
FT                   /tissue_type="brain"
FT                   /db_xref="taxon:10090"
FT   CDS             1..1278
FT                   /codon_start=1
FT                   /product="adipose differentiation-related protein"
FT                   /note="Adfp"
FT                   /db_xref="GOA:P43883"
FT                   /db_xref="InterPro:IPR004279"
FT                   /db_xref="MGI:MGI:87920"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43883"
FT                   /protein_id="AAK63075.1"
FT                   /translation="MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRS
FT                   VCEMAEKGVKTVTSAAMTSALPIIQKLEPQIAVANTYACKGLDRMEERLPILNQPTSEI
FT                   VASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDKTKGAVTGSVERTKSVVNGSINTV
FT                   LGMVQFMNSGVDNAITKSELLVDQYFPLTQEELEMEAKKVEGFDMVQKPSNYERLESLS
FT                   TKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHLIEFARKNMHSANQKIQGAQDKLYV
FT                   SWVEWKRSIGYDDTDESHCVEHIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQ
FT                   AKHLGVMAGDIYSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWL
FT                   VGPFYPQSTEVNKASLKVQQSEVKAQ"
XX
SQ   Sequence 1381 BP; 361 A; 342 C; 380 G; 298 T; 0 other;
     atggcagcag cagtagtgga tccgcaacag agcgtggtga tgagagtggc caacctgccc        60
     ttggtgagct ctacctacga ccttgtgtcc tccgcttatg tcagtacaaa ggatcagtac       120
     ccgtatttga gatccgtgtg tgagatggcc gagaagggcg tgaagaccgt gacctctgcg       180
     gccatgacaa gtgccctgcc catcatccag aagctggagc cacaaattgc ggttgccaat       240
     acctatgcct gcaaggggct agacaggatg gaggaaagac tgcctattct gaaccagcca       300
     acgtccgaga ttgttgccag tgccagaggt gccgtaactg gggcgaagga tgtggtgacg       360
     actaccatgg ctggagccaa ggattctgta gccagcacag tctcaggggt ggtggataag       420
     accaaaggag cagtgactgg cagcgtggaa aggaccaagt ctgtggtcaa tggcagcatc       480
     aatacagttt tggggatggt gcagttcatg aacagtggag tagataatgc catcaccaag       540
     tcggagctgc tggtagacca gtacttccct ctcactcagg aggagctgga gatggaagca       600
     aaaaaggtgg aaggatttga tatggttcag aagccgagca actatgaacg gctggagtcc       660
     ctgtctacca agctctgctc tcgggcttat caccaggctc tcagcagggt taaagaggcc       720
     aaacaaaaga gccaggagac catttctcag ctccactcca ctgtccacct gattgaattc       780
     gccaggaaga atatgcacag tgccaaccag aaaattcagg gtgctcagga taagctctat       840
     gtctcgtggg tggagtggaa gagaagcatc ggctacgacg acaccgatga gtcccactgt       900
     gttgagcaca tcgagtcacg tactctggct atcgcccgca acctgaccca gcagctccag       960
     actacatgcc agactgtcct ggtcaacgcc caagggttac cacagaacat tcaagatcag      1020
     gccaaacact tgggggtgat ggcaggcgac atctactccg tattccgcaa tgctgcctcc      1080
     tttaaggaag tgtccgatgg cgtcctcaca tctagcaagg ggcagctgca gaaaatgaag      1140
     gaatccttag atgaagttat ggattacttt gttaacaaca cgcctctcaa ctggctggta      1200
     ggtccctttt atcctcagtc taccgaggtg aacaaggcca gcctgaaggt ccagcagtct      1260
     gaggtcaaag ctcagtaaac ccctccttgt caccagagca tgatgttgct ggccagatga      1320
     ccccttttgc tgtattgaaa ttaacttggt agatggcttt agcttagaaa agcagcttct      1380
     t                                                                      1381
//


spacer
spacer