Dbfetch

ID   AY035844; SV 1; linear; mRNA; STD; MUS; 573 BP.
XX
AC   AY035844;
XX
DT   03-JUN-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus G-protein gamma 7 mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-573
RA   Xiong X., Han J.;
RT   "Mouse G-protein gamma 7 cDNA";
RL   Unpublished.
XX
RN   [2]
RP   1-573
RA   Xiong X., Han J.;
RT   ;
RL   Submitted (16-MAY-2001) to the INSDC.
RL   Immunology, The Scripps Research Institute, 10550 North Pines Road, La
RL   Jolla, CA 92122, USA
XX
DR   MD5; ece9eaa4eef7fc3ba2886c4d9ba362ba.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017508; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017470; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017924; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016860; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017265; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017371; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017965; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016920; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000117805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118465; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026361; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0026333; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0026301; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026307; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026110; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0026038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0026163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0026158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0026273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026155; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025389; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025639; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..573
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /cell_line="L929"
FT                   /db_xref="taxon:10090"
FT   CDS             142..348
FT                   /codon_start=1
FT                   /product="G-protein gamma 7"
FT                   /db_xref="GOA:Q61016"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:95787"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61016"
FT                   /protein_id="AAK61365.1"
FT                   /translation="MSGTNNVAQARKLVEQLRIEAGIERIKVSKASSDLMGYCEQHARN
FT                   DPLLVGVPASENPFKDKKPCIIL"
XX
SQ   Sequence 573 BP; 118 A; 162 C; 149 G; 144 T; 0 other;
     aggccccgcg gtgcgttcgg ctgtgcggct gctgagacac tggctggagg cagggtgtga        60
     agcctttcta ttggaacctc agtgctggga cggtgggacg gtgcagctct ctagacgcca       120
     ggtccacgct catggccgat gatgtcaggt actaacaacg tcgcccaggc ccggaagctg       180
     gtggagcagc tgcgcattga agctgggatc gaacgcatca aggtctccaa ggcctcgtca       240
     gacctgatgg gctactgtga gcaacatgcc cgcaacgatc ccttgctggt tggcgtgcca       300
     gcctctgaga atccattcaa agacaaaaag ccttgcataa ttctctagtt ctctctcttt       360
     ctctctctct tccccatctc tccctctctt tctccccacc ccggaggtat tggtccaatt       420
     tttcctgtaa ggaaaatatt tgaatccttc ccactttgaa ttctaaagga acaaaaacca       480
     ttgtgaatgc cgggatcttc ctgacctagc tggagtttat gaacccaggt ggggctctga       540
     ctgtcgcctg gcctaactga gatgttagcc tcg                                    573
//