spacer

EBI Dbfetch

ID   AY015062; SV 1; linear; mRNA; STD; MUS; 955 BP.
XX
AC   AY015062;
XX
DT   05-DEC-2001 (Rel. 70, Created)
DT   05-DEC-2001 (Rel. 70, Last updated, Version 1)
XX
DE   Mus musculus LATS2C (Lats2) mRNA, complete cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-955
RA   Chen Y.-G., Mantalaris A., Wu J.H.D.;
RT   "Identification and Tissue Distribution of Two Novel Spliced Variants of
RT   the Mouse Lats2 Gene";
RL   Unpublished.
XX
RN   [2]
RP   1-955
RA   Chen Y.-G., Mantalaris A., Wu J.H.D.;
RT   ;
RL   Submitted (28-NOV-2000) to the INSDC.
RL   Chemical Engineering, University of Rochester, 206 Gavett Hall, Rochester,
RL   NY 14627, USA
XX
DR   MD5; 851663c8b2a0fba904987cd28933395f.
DR   Ensembl-Gn; ENSMUSG00000021959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038381; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..955
FT                   /organism="Mus musculus"
FT                   /chromosome="14"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             85..762
FT                   /codon_start=1
FT                   /gene="Lats2"
FT                   /product="LATS2C"
FT                   /note="splice variant"
FT                   /db_xref="GOA:Q8VHE1"
FT                   /db_xref="InterPro:IPR028742"
FT                   /db_xref="MGI:MGI:1354386"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VHE1"
FT                   /protein_id="AAK07726.1"
FT                   /translation="MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDT
FT                   SLDAKVLGSKDASRQQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQ
FT                   ELVNAGCDQVALNSQRYVCLSLSSAGVKGLCQKCVFIRKVSVADRLCSRLWKILNRSTM
FT                   HIPGACLFLEMLLSVPPISQTAAPGLQAHRLLQLCSVCEFKLGPSHLYLKHGASRLLSP
FT                   LCP"
XX
SQ   Sequence 955 BP; 253 A; 228 C; 234 G; 240 T; 0 other;
     cactgacact gttgactgtt ctctttaaaa taataagacg ctttgagaag attgtattta        60
     tggtaaaagg aaactggact aacaatgagg ccaaagactt ttcctgccac aacttactct       120
     ggaaatagcc ggcagcgatt gcaagagatt cgagaggggc tgaagcagcc atccaaggct       180
     tccacccagg ggctgctggt gggaccaaac agtgacactt ccctggatgc caaagtcctg       240
     gggagcaaag atgcctccag gcagcagcaa atgagagcca ccccgaagtt tggaccttat       300
     caaaaagctc tcagggaaat ccgatattcc ctcctgcctt ttgccaacga gtcaggcact       360
     tcggcagctg cagaggtgaa ccggcagatg cttcaggagt tggtgaatgc gggatgtgac       420
     caggtggcct tgaactcaca gagatatgtt tgcctcagcc tctcaagtgc tggggtgaaa       480
     ggcctgtgtc agaaatgcgt cttcataagg aaggtatcag tggctgatcg cctgtgttcc       540
     aggctgtgga agatcttgaa ccggtcaaca atgcatattc ctggtgcgtg tctgtttctg       600
     gagatgctcc tgtctgtccc tcccatctcc caaacagcag cacctggatt acaggcacac       660
     aggctgctac agctttgcag tgtgtgcgaa ttcaagctcg gaccctcaca cttgtacctg       720
     aagcacggag ccagccgtct tctcagcccc ttatgtccat aatactaggg cttgattctg       780
     aacgtgagag gaaatgtggc acttggcttt ctgaacttgg ctgattttgc tccatggatg       840
     acctcaaatt gcatccatgg ttacagtttt ttgtcattct tacaaatgtg actttgtcct       900
     tcgatatggc ctaataaaac gcctttgtgc ttaaaaaaaa aaaaaaaaaa aaaaa            955
//


spacer
spacer