Dbfetch

ID   AY015061; SV 1; linear; mRNA; STD; MUS; 808 BP.
XX
AC   AY015061;
XX
DT   05-DEC-2001 (Rel. 70, Created)
DT   05-DEC-2001 (Rel. 70, Last updated, Version 1)
XX
DE   Mus musculus LATS2B (Lats2) mRNA, complete cds, alternatively spliced.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-808
RA   Chen Y.-G., Mantalaris A., Wu J.H.D.;
RT   "Identification and Tissue Distribution of Two Novel Spliced Variants of
RT   the Mouse Lats2 Gene";
RL   Unpublished.
XX
RN   [2]
RP   1-808
RA   Chen Y.-G., Mantalaris A., Wu J.H.D.;
RT   ;
RL   Submitted (28-NOV-2000) to the INSDC.
RL   Chemical Engineering, University of Rochester, 206 Gavett Hall, Rochester,
RL   NY 14627, USA
XX
DR   MD5; cc1ff284dd4570604519ecebf3329092.
DR   Ensembl-Gn; ENSMUSG00000021959; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0021410; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0021371; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021346; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021374; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021153; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021813; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0020671; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021120; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021241; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021222; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021316; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021250; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021837; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0020414; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0020723; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000077981; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0039701; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0039672; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0039625; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0039672; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0039409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0040146; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0039409; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0039328; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0039473; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0039443; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0039561; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0039431; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0040180; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0039022; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0038804; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..808
FT                   /organism="Mus musculus"
FT                   /chromosome="14"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /tissue_type="bone marrow"
FT                   /db_xref="taxon:10090"
FT   CDS             85..615
FT                   /codon_start=1
FT                   /gene="Lats2"
FT                   /product="LATS2B"
FT                   /note="splice variant"
FT                   /db_xref="MGI:MGI:1354386"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VHE2"
FT                   /protein_id="AAK07725.1"
FT                   /translation="MRPKTFPATTYSGNSRQRLQEIREGLKQPSKASTQGLLVGPNSDT
FT                   SLDAKVLGSKDASRQQQMRATPKFGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQ
FT                   ELVNAGCDQMHIPGACLFLEMLLSVPPISQTAAPGLQAHRLLQLCSVCEFKLGPSHLYL
FT                   KHGASRLLSPLCP"
XX
SQ   Sequence 808 BP; 219 A; 196 C; 191 G; 202 T; 0 other;
     cactgacact gttgactgtt ctctttaaaa taataagacg ctttgagaag attgtattta        60
     tggtaaaagg aaactggact aacaatgagg ccaaagactt ttcctgccac aacttactct       120
     ggaaatagcc ggcagcgatt gcaagagatt cgagaggggc tgaagcagcc atccaaggct       180
     tccacccagg ggctgctggt gggaccaaac agtgacactt ccctggatgc caaagtcctg       240
     gggagcaaag atgcctccag gcagcagcaa atgagagcca ccccgaagtt tggaccttat       300
     caaaaagctc tcagggaaat ccgatattcc ctcctgcctt ttgccaacga gtcaggcact       360
     tcggcagctg cagaggtgaa ccggcagatg cttcaggagt tggtgaatgc gggatgtgac       420
     cagatgcata ttcctggtgc gtgtctgttt ctggagatgc tcctgtctgt ccctcccatc       480
     tcccaaacag cagcacctgg attacaggca cacaggctgc tacagctttg cagtgtgtgc       540
     gaattcaagc tcggaccctc acacttgtac ctgaagcacg gagccagccg tcttctcagc       600
     cccttatgtc cataatacta gggcttgatt ctgaacgtga gaggaaatgt ggcacttggc       660
     tttctgaact tggctgattt tgctccatgg atgacctcaa attgcatcca tggttacagt       720
     tttttgtcat tcttacaaat gtgactttgt ccttcgatat ggcctaataa aacgcctttg       780
     tgcttaaaaa aaaaaaaaaa aaaaaaaa                                          808
//