spacer

EBI Dbfetch

ID   AY011270; SV 1; linear; genomic DNA; STD; MUS; 827 BP.
XX
AC   AY011270;
XX
DT   07-FEB-2001 (Rel. 66, Created)
DT   02-NOV-2012 (Rel. 114, Last updated, Version 2)
XX
DE   Mus musculus beta-2 adrenergic receptor (Adrb2) gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-827
RX   DOI; 10.1038/35054550.
RX   PUBMED; 11214319.
RA   Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.P., Ryder O.A.,
RA   O'Brien S.J.;
RT   "Molecular phylogenetics and the origins of placental mammals";
RL   Nature 409(6820):614-618(2001).
XX
RN   [2]
RP   1-827
RA   Murphy W.J., Eizirik E., Johnson W.E., Zhang Y.P., Ryder O.A.,
RA   O'Brien S.J.;
RT   ;
RL   Submitted (01-NOV-2000) to the INSDC.
RL   Laboratory of Genomic Diversity, National Cancer Institute-FCRDC, P.O. Box
RL   B, Bldg. 560, Rm. 11-10, Frederick, MD 21702, USA
XX
DR   MD5; c8c2bab4417d7d2e7d076d39c0b44c34.
DR   Ensembl-Gn; ENSMUSG00000045730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053640; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..827
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>827
FT                   /gene="Adrb2"
FT   mRNA            <1..>827
FT                   /gene="Adrb2"
FT                   /product="beta-2 adrenergic receptor"
FT   CDS             <1..>827
FT                   /codon_start=1
FT                   /gene="Adrb2"
FT                   /product="beta-2 adrenergic receptor"
FT                   /db_xref="GOA:Q99P03"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000332"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q99P03"
FT                   /protein_id="AAG35430.1"
FT                   /translation="VLVITAIAKFERLQTVTNYFIISLACADLVMGLAVVPFGASHILM
FT                   KMWNFGNFWCEFWTSIDVLCVTASIETLCVIAVDRYVAITSPFKYQSLLTKNKARVVIL
FT                   MVWIVSGLTSFLPIQMHWYRATHKKAIDCYTEETCCDFFTNQAYAIASSIVSFYVPLVV
FT                   MVFVYSRVFQVAKRQLQKIDKSEGRFHAQNLSQVEQDGRSGHGLRRSSKFCLKEHKALK
FT                   TLGIIMGTFTLCWLPFFIVNIVHVIRDNLIPKEVYILLNWLGYVNSAFNPLIY"
XX
SQ   Sequence 827 BP; 182 A; 228 C; 199 G; 218 T; 0 other;
     gtgctggtca tcacagccat tgccaagttc gagcgactac aaaccgtcac caactacttc        60
     ataatctcct tggcgtgtgc tgatctagtc atgggcctag cggtggtgcc gtttggggcc       120
     agtcacatcc ttatgaaaat gtggaatttt ggcaacttct ggtgcgagtt ctggacttcc       180
     attgatgtgt tgtgcgtcac agccagcatc gagaccctgt gcgtgattgc agtggatcgc       240
     tatgttgcta tcacatcgcc cttcaagtac cagagcctgc tgaccaagaa taaggcccga       300
     gtggtcatcc tgatggtatg gattgtatct ggccttacct cctttttgcc tatccagatg       360
     cactggtacc gtgccaccca caagaaagct atcgattgtt acaccgagga gacttgctgt       420
     gacttcttca cgaaccaggc ctacgccatc gcgtcctcga ttgtgtcttt ctacgtgccc       480
     ctggtggtga tggtctttgt ctattcccgg gtcttccagg tggccaaaag gcagctgcag       540
     aagatagaca aatctgaagg aagattccac gcccaaaacc tcagccaggt ggagcaggat       600
     gggcggagcg gccacggact ccgaaggtcc tccaagttct gcttgaaaga gcacaaagcc       660
     ctcaagactt taggcatcat catgggcaca ttcaccctct gctggctgcc cttcttcatt       720
     gtcaatatcg tgcacgttat cagggacaac ctcatcccta aggaagttta catcctcctt       780
     aactggttgg gctacgtcaa ctctgccttc aatcctctta tctactg                     827
//


spacer
spacer