spacer

EBI Dbfetch

ID   AY007238; SV 1; linear; mRNA; STD; MUS; 2820 BP.
XX
AC   AY007238;
XX
DT   10-MAR-2002 (Rel. 71, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus putative protein O-mannosyltransferase POMT1 mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2820
RA   Wang X., Jigami Y.;
RT   "A putative mouse O-mannosyltransferase mPOMT1";
RL   Unpublished.
XX
RN   [2]
RP   1-2820
RA   Wang X., Jigami Y.;
RT   ;
RL   Submitted (17-AUG-2000) to the INSDC.
RL   Molecular Biology, National Institute of Bioscience and Human-Technology,
RL   Agency of Industrial Science and Technology, 1-1, Higashi, Tsukuba, Ibaraki
RL   305, Japan
XX
DR   MD5; a53a09532e6915a95a8767b709d28392.
DR   Ensembl-Gn; ENSMUSG00000039254; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036473; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2820
FT                   /organism="Mus musculus"
FT                   /strain="BALB/c"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /dev_stage="9-11 weeks"
FT                   /db_xref="taxon:10090"
FT   CDS             64..2304
FT                   /codon_start=1
FT                   /product="putative protein O-mannosyltransferase POMT1"
FT                   /db_xref="GOA:Q8R2R1"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="InterPro:IPR016093"
FT                   /db_xref="InterPro:IPR027005"
FT                   /db_xref="MGI:MGI:2138994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R2R1"
FT                   /protein_id="AAG15588.1"
FT                   /translation="MGSHSTGLEETLGVLPSWLFCKMLRFLKRPLVVTVDINLNLVALT
FT                   GLGLLTRLWQLSYPRAVVFDEVYYGQYISFYMKRIFFLDDSGPPFGHMLLALGGWLGGF
FT                   DGNFLWNRIGAEYSSNVPIWSLRLLPALAGALSVPMAYQIVLELHFSHGAAIGAALLML
FT                   IENALITQSRLMLLESILIFFNLLAVLSYLKFFNSQTHSPFSVHWWLWLLLTGVSCSCA
FT                   VGIKYMGIFTYLLVLGIAAVHAWNLIGDQTLSNMPVLSHLLARIVALLVVPVFLYLLFF
FT                   YVHLMLLYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVAFGSQVTLESVSGKPLPCW
FT                   LHSHKNTYPMIYENGRGSSHQQQVTCYPFKDINNWWIVKDPGRHQLVVNNPPRPVRHGD
FT                   IVQLVHGMTTRLLNTHDVAAPLSPHSQEVSCYIDYNISMPAQNLWKLDIVNRESNRDTW
FT                   KTILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKLSPGYHESMVWNVEEHRYGK
FT                   SHEQKERELELHSPTQLDISRNLSFMARFSELQWKMLTLKNEDLEHQYSSTPLEWLTLD
FT                   TNIAYWLHPRTSAQIHLLGNIVIWTSASLATVVYTLLFFWYLLRRRRSICDLPEDAWSR
FT                   WVLAGALCTGGWALNYLPFFLMERVLFLYHYLPALTFQILLLPIVLQHASDHLCRSQLQ
FT                   RNVFSALVVAWYSSACHVSNMLRPLTYGDTSLSPGELRALRWKDSWDILIRK"
XX
SQ   Sequence 2820 BP; 612 A; 829 C; 729 G; 650 T; 0 other;
     gtaatcgagc ggcctcgccc ccaacggtcg atcctgcctg gcggttcgca ggcctggctc        60
     cacatgggga gccactctac gggactcgaa gaaacgctcg gagtcctccc gagctggctt       120
     ttctgcaaaa tgttaagatt tttgaaacgg cctctagtgg tgactgttga catcaatttg       180
     aacttggtag ctctgactgg cctgggacta cttacccgac tatggcaact ctcctaccct       240
     cgggctgtgg ttttcgatga agtatattat gggcagtaca tttccttcta catgaagcgc       300
     atcttctttc tggatgacag tgggccacca tttggccaca tgctactggc cttaggaggt       360
     tggttagggg gattcgatgg taactttctg tggaaccgaa ttggagcaga gtacagtagc       420
     aatgtgccta tatggtcctt acgcctgctg ccagcgcttg ccggggccct gtcagtgccc       480
     atggcctacc agatagtgct agagctccac ttttcccacg gtgctgccat tggagccgcc       540
     ctgctgatgc tcattgagaa cgccctgatc actcagtcca ggctcatgct gttggagtcc       600
     atactgatat tttttaacct gttggctgtg ttgtcctatc tgaagttctt caactcccag       660
     acacacagcc ctttctcagt gcactggtgg ctgtggctac tgctgaccgg ggtctcttgt       720
     tcctgtgcag ttgggatcaa atacatgggg attttcacct acctgcttgt gctcggcatt       780
     gcagctgtcc acgcgtggaa tctgatcgga gaccagacct tgtcaaatat gcccgtgctc       840
     agtcacttgc tcgccagaat cgtggctctg ctggtcgtcc cagtcttcct gtacttactc       900
     ttcttctatg tccacctgat gctgctctac cggtctgggc cccatgacca aatcatgtcc       960
     agtgccttcc aggccagctt ggagggaggg cttgcccgca tcacccaagg ccagcccctg      1020
     gaggtggcct ttggttccca ggtcactctg gagagcgtct ctggcaaacc cttgccctgc      1080
     tggcttcatt cgcacaagaa cacctatccc atgatatatg agaatggccg tggcagctcc      1140
     caccagcaac aggtgacctg ttatcccttc aaagacatca ataactggtg gatcgtcaag      1200
     gatcctgggc gacaccagct ggtggtaaac aaccctcccc ggcctgtaag acatggagac      1260
     attgtacagc tcgttcacgg catgaccacc cgcctcctta acacgcacga tgtcgcagcc      1320
     ccactgagcc cccattctca agaagtctcc tgctacattg actataacat ctccatgcct      1380
     gcccagaacc tctggaaact ggacattgtg aacagagagt ccaaccggga tacctggaag      1440
     actatcttgt cggaagtgcg ctttgtacat gtgaacacat ccgccatctt gaagctgagc      1500
     ggggctcacc tccctgactg ggggttccgg cagttggagg tagttgggga gaagttgtca      1560
     ccgggctacc acgagagcat ggtgtggaat gtggaagaac accggtatgg caaaagccat      1620
     gagcagaagg agagggagct ggagctccac tcgcccactc agctcgatat cagcaggaac      1680
     ctcagcttca tggccagatt ctcagagtta cagtggaaga tgctgacgct gaagaatgag      1740
     gacttggaac accagtacag ctccaccccg ctggagtggc tcacgctgga caccaacatc      1800
     gcctattggc tacatcccag gaccagtgct cagatccact tgcttgggaa cattgtgatc      1860
     tggacttcag ccagccttgc cacagtggtc tacactctac tcttcttctg gtacctgctc      1920
     cgccggcgaa ggagcatctg tgacctccct gaggatgcct ggtcccgctg ggtgctggct      1980
     ggagccctgt gtactggcgg ctgggcactc aactacctgc ccttcttcct gatggagagg      2040
     gtgctcttcc tctaccacta cttgccggca ctcaccttcc agatcctgct gctcccgatt      2100
     gtcctgcagc acgccagcga ccatctgtgc aggtcccagc tgcagaggaa tgtcttcagt      2160
     gccctggttg tagcatggta ttcctccgca tgccatgtgt ccaacatgct acgcccacta      2220
     acctatgggg acacgtcact ctcaccaggc gagctccggg cccttcgctg gaaagacagc      2280
     tgggatattc tgatccgaaa gtaatagaga acaagaacac agaagacaag cacacaggac      2340
     aaagcctcaa agatgtgttt gtctcccacc aacaggagcc tcagcaggca ggactgccag      2400
     ggtccaggag gaactccagg gactaattcc aatttcacct caagagccct gtccactggt      2460
     tccttgtttg aagcaattga tttctcttca cacagtgaag aatgtgccca gccacagcgt      2520
     tacccatgag gcccaactct gacccagcca gagtttgagc tgccagtgta ggaaccacca      2580
     aggcaggagg ggcaccagcc agggaaggag tgggggggac tcaggacgag ctgcgggcct      2640
     actatagggc cttagccctg tcatttatgg ggcccacagt gccacacctc attgggcaca      2700
     ggcacagcca ccctctgtaa accctgaaag ctgccagcca tccacagact cctgagccaa      2760
     ctctaaagag tcctgggaga ctgcagccac ctaactgcca cggccaaggt gtcgtccatt      2820
//


spacer
spacer