spacer

EBI Dbfetch

ID   AY007112; SV 1; linear; mRNA; STD; HUM; 1232 BP.
XX
AC   AY007112;
XX
DT   06-SEP-2000 (Rel. 65, Created)
DT   15-OCT-2008 (Rel. 97, Last updated, Version 2)
XX
DE   Homo sapiens clone TCCCTA00141 mRNA sequence.
XX
KW   FLI_CDNA.
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1232
RX   DOI; 10.1006/abio.1996.0138.
RX   PUBMED; 8619474.
RA   Andersson B., Wentland M.A., Ricafrente J.Y., Liu W., Gibbs R.A.;
RT   "A "double adaptor" method for improved shotgun library construction";
RL   Anal. Biochem. 236(1):107-113(1996).
XX
RN   [2]
RP   1-1232
RX   PUBMED; 9110174.
RA   Yu W., Andersson B., Worley K.C., Muzny D.M., Ding Y., Liu W.,
RA   Ricafrente J.Y., Wentland M.A., Lennon G., Gibbs R.A.;
RT   "Large-scale concatenation cDNA sequencing";
RL   Genome Res. 7(4):353-358(1997).
XX
RN   [3]
RP   1-1232
RA   Zhou J., Yu W., Tang H., Mei G., Tsang Y.T.M., Bouck J., Gibbs R.A.,
RA   Margolin J.F.;
RT   ;
RL   Submitted (24-JUL-2000) to the INSDC.
RL   Human Genome Sequencing Center and Texas Children's Cancer Center, Baylor
RL   College of Medicine, Houston, TX 77030, USA
XX
DR   MD5; dcd698feb6cad1f9466d0dd0f896b42a.
DR   Ensembl-Gn; ENSG00000069329; homo_sapiens.
DR   Ensembl-Tr; ENST00000299138; homo_sapiens.
XX
CC   The clone request should be directed to Dr. J. Margolin at
CC   Pediatrics-Hematology & Oncology, Texas Children's FEIGIN Center
CC   102514, Houston, Texas 77030, USA. Telephone: 713-770-4583
CC   margolin@bcm.tmc.edu.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1232
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /dev_stage="infant"
FT                   /clone_lib="constructed by Y.T.M. Tsang"
FT                   /clone="TCCCTA00141"
FT                   /note="from patient with acute lymphoblastic leukemia"
FT                   /db_xref="taxon:9606"
FT   CDS             429..1001
FT                   /codon_start=1
FT                   /note="similar to Homo sapiens vacuolar sorting protein 35
FT                   (VPS35) mRNA with GenBank Accession Number AF191298"
FT                   /db_xref="GOA:Q96QK1"
FT                   /db_xref="H-InvDB:HIT000083050.11"
FT                   /db_xref="HGNC:HGNC:13487"
FT                   /db_xref="InterPro:IPR005378"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="PDB:2R17"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q96QK1"
FT                   /protein_id="AAG01989.1"
FT                   /translation="MSQAFSLYEDEISDSKAQLAAITLIIGTFERMKCFSEENHEPLRT
FT                   QCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEELHGGKRVMECLKKALKIANQC
FT                   MDPSLQVQLFIEILNRYIYFYEKENDAVTIQVLNQLIQKIREDLPNLESSEETEQINKH
FT                   FHNTLEHLRLRRESPESEGPIYEGLIL"
XX
SQ   Sequence 1232 BP; 392 A; 263 C; 262 G; 315 T; 0 other;
     gcggccgcgt cgatcaagat cagccagatc aacctgtaga agaccctgat ccagaagatt        60
     ttgctgatga gcagagcctt gtgggccgct tcattcatct gctgcgctct gaggaccctg       120
     accagcagta cttgattttg aacacagcac gaaaacattt tggagctggt ggaaatcagc       180
     ggattcgctt cacactgcca cctttggtat ttgcagctta ccagctggct tttcgatata       240
     aagagaattc taaagtggat gacaaatggg aaaagaaatg ccagaagatt ttttcatttg       300
     cccaccagac tatcagtgct ttgatcaaag cagagctggc agaattgccc ttaagacttt       360
     ttcttcaagg agcactagct gctggggaaa ttggttttga aaatcatgag acagtcgcat       420
     atgaattcat gtcccaggca ttttctctgt atgaagatga aatcagcgat tccaaagcac       480
     agctagctgc catcaccttg atcattggca cttttgaaag gatgaagtgc ttcagtgaag       540
     agaatcatga acctctgagg actcagtgtg cccttgctgc atccaaactt ctaaagaaac       600
     ctgatcaggg ccgagctgtg agcacctgtg cacatctctt ctggtctggc agaaacacgg       660
     acaaaaatgg ggaggagctt cacggaggca agagggtaat ggagtgccta aaaaaagctc       720
     taaaaatagc aaatcagtgc atggacccct ctctacaagt gcagcttttt atagaaattc       780
     tgaacagata tatctatttt tatgaaaagg aaaatgatgc ggtaacaatt caggttttaa       840
     accagcttat ccaaaagatt cgagaagacc tcccgaatct tgaatccagt gaagaaacag       900
     agcagattaa caaacatttt cataacacac tggagcattt gcgcttgcgg cgggaatcac       960
     cagaatccga ggggccaatt tatgaaggtc tcatccttta aaaaggaaat agctcaccat      1020
     actcctttcc atgtacatcc agtgagggtt ttattacgct aggtttccct tccatagatt      1080
     gtgcctttca gaaatgctga ggtaggtttc ccatttctta cctgtgatgt gttttaccca      1140
     gcacctccgg acactcacct tcaggacctt aataaaatta ttcacttggt aaaaaaaaaa      1200
     aaaaaaaaaa aaaaaaaaaa aaaaaaaaaa aa                                    1232
//


spacer
spacer